Open Close
General Information
Symbol
Dmel\Dscam1-PBM
Species
D. melanogaster
Annotation Symbol
CG17800-PBM
FlyBase ID
FBpp0297693
Associated gene
Length (aa)
2028
Theoretical pI
6.60
Predicted MW (kDa)
223.6
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MNMPNERLKWLMLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKASGNPMPEIIWIRSDGTA
VGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQFGSIISRDVHVRAVVKQFFESQVYDEYVIKGNAAIFKC
QTPSFVADHIDITDWIDTEGEVFTKNITDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEP
VSSTAPKVPPLQSRPMIVPGHTDLSILCPAQGYPAPSFRWYKFIEGTTRKQAVVLNDRVKQVSGTLIIKDAVVEDSGKYL
CVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKG
MYQCFVRNDQESAEASAELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQVGQYV
TVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVAGETLIVTCPVAGYPIDSIVWER
DNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNQEGYSARGSLEVQVMVPPKLAPLPVNSPLYVGDYYQLTCAV
VHGDAPFNITWYYNNEPAGDLAGVTILMHGRRSSSLNIESVGGDHAGNYTCKGANRAGETTAETHLSVKVPPRWILEPTD
KAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVDNIQKTNEGYYLCEAINGIGSGLSAV
IMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERS
DSALFTCVATNAFGSDDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWSEIDRVIV
PGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVEPVNQTTMRVTWKPPPRTEWNGEIL
GYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTAC
TTLTSQTIRVGWVSPPLESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAGGDGVRS
VPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGAETETKTQKVPHYQMSFEATELEKNKP
YEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIASFDDTFTATFKEDAKMPCLAVGAPQPEITWKIKGVEFSANDRMRVLP
DGSLLIKSVNRQDAGDYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTLHYKPEF
GEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKPKLPEKPRFIEVSSNSVSLHFKAWKDG
GCPMSHFVVESKKRDQIEWNQISNNVKPDNNYVVLDLEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIAPLDDGSG
HGNVHTRIRLPAWMPEWLDLNFMVPLIATVVVVAVGICVVCVALSRRRADDMRGGQKDVYYDVVYNQTMGPGATLDKRRP
DLRDELGYIAPPNRKLPPVPGSNYNTCDRIKRGRGGLRSNHSTWDPRRNPNLYEELKAPPVPMHGNHYGHAHGNAECHYR
HPGMEDEICPYATFHLLGFREEMDPTKAMNFQTFPHQNGHAGPVPGHAGTMLPPGHPGHVHSRSGSQSMPRANRYQRKNS
QGGQSSIYTPAPEYDDPANCAEEDQYRRYTRVNSQGGSLYSGPGPEYDDPANCAPEEDQYGSQYGGPYGQPYDHYGSRGS
MGRRSIGSARNPGNGSPEPPPPPPRNHDMSNSSFNDSKESNEISEAECDRDHGPRGNYGAVKRSPQPKDQRTTEEMRKLI
ERNETGPKQLQLQQANGAGFTAYDTMAV
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0306777
7735
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0089016
7699
FBtr0111049
7699
FBtr0111050
7744
FBtr0111051
7744
FBtr0111052
7702
FBtr0111053
7699
FBtr0111054
7744
FBtr0111055
7747
FBtr0111056
7699
FBtr0111057
7702
FBtr0111058
7741
FBtr0111059
7747
FBtr0111060
7699
FBtr0111061
7702
FBtr0111102
7762
FBtr0111062
7747
FBtr0111063
7717
FBtr0111064
7711
FBtr0111101
7753
FBtr0111065
7753
FBtr0111066
7705
FBtr0111067
7705
FBtr0111068
7753
FBtr0111069
7753
FBtr0111070
7708
FBtr0111071
7705
FBtr0111072
7756
FBtr0111073
7756
FBtr0111074
7711
FBtr0111075
7741
FBtr0111076
7741
FBtr0111077
7744
FBtr0111078
7744
FBtr0111079
7744
FBtr0111080
7756
FBtr0306773
7741
FBtr0306774
7750
FBtr0306775
7756
FBtr0306776
7708
FBtr0306778
7759
FBtr0306779
7708
FBtr0306780
7708
FBtr0306781
7762
FBtr0306782
7747
FBtr0306783
7699
FBtr0306784
7699
FBtr0306785
7753
FBtr0306786
7759
FBtr0306787
7699
FBtr0306767
7764
FBtr0306768
7710
FBtr0306769
7755
FBtr0089018
7699
FBtr0306770
7755
FBtr0306771
7710
FBtr0306772
7755
FBtr0334801
9145
FBtr0089019
7708
FBtr0089020
7717
FBtr0111081
7744
FBtr0111082
7747
FBtr0111083
7702
FBtr0111084
7702
FBtr0111085
7699
FBtr0111087
7744
FBtr0111088
7702
FBtr0111089
7744
FBtr0111092
7690
FBtr0111094
7747
FBtr0111096
7699
FBtr0111097
7708
FBtr0111098
7744
FBtr0111099
7756
FBtr0111100
7702
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0088088
2016
FBpp0110341
2016
FBpp0110342
2031
FBpp0110343
2031
FBpp0110344
2017
FBpp0110345
2016
FBpp0110346
2031
FBpp0110347
2032
FBpp0110348
2016
FBpp0110349
2017
FBpp0110350
2030
FBpp0110351
2032
FBpp0110352
2016
FBpp0110353
2017
FBpp0110354
2037
FBpp0110355
2032
FBpp0110356
2022
FBpp0110357
2020
FBpp0110358
2034
FBpp0110359
2034
FBpp0110360
2018
FBpp0110361
2018
FBpp0110362
2034
FBpp0110363
2034
FBpp0110364
2019
FBpp0110365
2018
FBpp0110366
2035
FBpp0110367
2035
FBpp0110368
2020
FBpp0110369
2030
FBpp0110370
2030
FBpp0110371
2031
FBpp0110372
2031
FBpp0110373
2031
FBpp0110374
2035
FBpp0297689
2030
FBpp0297690
2033
FBpp0297691
2035
FBpp0297692
2019
FBpp0297694
2036
FBpp0297695
2019
FBpp0297696
2019
FBpp0297697
2037
FBpp0297698
2032
FBpp0297699
2016
FBpp0297700
2016
FBpp0297701
2034
FBpp0297702
2036
FBpp0297703
2016
FBpp0297683
2038
FBpp0297684
2020
FBpp0297685
2035
FBpp0088090
2016
FBpp0297686
2035
FBpp0297687
2020
FBpp0297688
2035
FBpp0306847
1947
FBpp0088091
2019
FBpp0089327
2022
FBpp0110375
2031
FBpp0110376
2032
FBpp0110377
2017
FBpp0110378
2017
FBpp0110379
2016
FBpp0110381
2031
FBpp0110382
2017
FBpp0110384
2031
FBpp0110387
2013
FBpp0110389
2032
FBpp0110391
2016
FBpp0110392
2019
FBpp0110393
2031
FBpp0110394
2035
FBpp0110395
2017
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
Dscam-PBM
Dscam1-PBM
Name Synonyms
Secondary FlyBase IDs
    References (0)