Open Close
General Information
Symbol
Dmel\ced-6-PD
Species
D. melanogaster
Annotation Symbol
CG11804-PD
FlyBase ID
FBpp0297720
Associated gene
Length (aa)
533
Theoretical pI
8.22
Predicted MW (kDa)
57.9
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MIKSSLKRLKTAPTTTMPYQPANSGGTSGGSKAAAKMAQLKFWNKQNSSKQQQQDKDKDAADGGNNTSGGGTGSNSNGDA
KSEAKNGKRNWLHTPEQLISGHAVYLVKFFGNLSVDQPKGIEVVKEAIRKLQFAQQMKKAETGTQEKFKKLEITISIKGV
AIQEPRTHKILHQFPLYNISYCADEKGVKKFFSFIAKTVKTQDGSDPTSNGHANGNGDGSAKVEESHECFVFISNKLASD
ITLTIGQAFDLAYRKYMDSTEKTNLSKAQQQINHLQQTVNVYKERLREVSAKLPKAELDALLFNLGIKDILEAPTTEPQN
GIEVASEALSNGKLDDDKLLIDTNSTTASTHSASPSSFLPIVPPRNNLSSQISIGGKSNSQKMDELLLNSDSDSDFDPRA
DETQEIGGTGRSAISNMFGFEPANSFGQHLFSNNNDHKLQNNNSSLLITSNNNSINSSGFSSELNITPPLLAPPPKIAAP
RRLNSVTTGNGLNGNTDLFGSDPFELNNGPNIFKQNQLNLDDFSLESLDPLRK
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0306808
2462
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0088550
2382
FBtr0088548
2572
FBtr0088549
2257
FBtr0339384
2563
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0087633
517
FBpp0087631
517
FBpp0087632
517
FBpp0308475
514
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
ced-6-PD
Name Synonyms
Secondary FlyBase IDs
    References (0)