Open Close
General Information
Symbol
Dmel\CG43340-PJ
Species
D. melanogaster
Annotation Symbol
CG43340-PJ
FlyBase ID
FBpp0297791
Associated gene
Length (aa)
968
Theoretical pI
5.11
Predicted MW (kDa)
106.3
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MAGEVPAETSPVGCNTSNSQGSSPHPDPIQQQQLNSSVDSGIAVLEAESPTLRRRQRLHQCQRILQVLQRDQLTHQQLRD
RLSKLANKKWRKEESSSEDHACNVCCADLDLSSAKNYVTCCTCEKSVCRGPKCADWRPKDAKWECQLCQSSKESLAHTSS
WVAEQMSFNQHKFVYPMRARSEVYIPIVGDGNDSSMQFESVSQIGQNAHMDERAKIREYVEEIVAEMLGGNLDHVKVGQL
SKSENYLQLFDKFHAKLSNLLINVENSLCARALRGDLPAIVNGHTNNSNNNNNNNHADSELADLSQTRLRSLIETIIAET
LRSSTLSASGAVSEISLDTRSHVSDLANGNGLKRRHRTEHYFEPKIYQDLLATAVLNKIVDKEGNTRLAAESTPDLSGRH
IDENFNAEALSTTSGSSIEPRSDCSLTDHEIGLDNGKSQSLQTDLERESVLSDYIAAHMVPLPDFSASVTESEDDIGSIS
SGMIGDGNWEDNWLFKKKRSSATPSSIGMLVPAPRENVRAQIGDKTTDEVSDLSEIGSDIEESSLDLLRCNDLNDRLLSK
HLIGGQNTKMVLDELVDRTSLTSHTLPEENEPAFTETTNEFVVSPMAMPSDIKAPSPTPPPPPMIFQDDLLNEEPDHTPI
AGSIAEREVKKWYNAVEMPNNPYSPEALKQRISGTQERYMDVPNISPSAEQKALASALTENPDPPAPKADYKRYSRDYYI
NNAPTSTDSTGGGKAATTSAGEDVEDIVINEVNQEPEPHPPHGRISSGAQSTAADLSHWTLSTPVRRSSSLKFINSRPFH
SPSPSLGYERSVPLERPSTSASHYRESSLGLGDDDDFDLRSQRSWRSSYSSLPKRHTQSSLSLHSNGSGVSFGSSVSKRR
PAAGGPSAGVLTQFEKQLLHKDLKRNSFRAVSATSKDFVMNPLFESEPLGEKPALRPETEDQGDSGVDSCLNGFSGADAK
YSNNSLLF
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0306938
3941
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0306931
3681
FBtr0306933
3851
FBtr0306932
3947
FBtr0306934
3012
FBtr0306935
3544
FBtr0306937
3384
FBtr0306936
3976
FBtr0306939
3248
FBtr0306940
3181
FBtr0306941
10517
FBtr0306942
9266
FBtr0306943
9424
FBtr0331951
3585
FBtr0331952
8164
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0297784
983
FBpp0297786
938
FBpp0297785
1020
FBpp0297787
723
FBpp0297788
983
FBpp0297790
847
FBpp0297789
1020
FBpp0297792
723
FBpp0297793
723
FBpp0297794
3213
FBpp0297795
2796
FBpp0297796
2893
FBpp0304284
901
FBpp0304285
2544
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG43340-PJ
Name Synonyms
Secondary FlyBase IDs
    References (0)