Open Close
General Information
Symbol
Dmel\Rab3-GEF-PD
Species
D. melanogaster
Annotation Symbol
CG5627-PD
FlyBase ID
FBpp0298037
Associated gene
Length (aa)
2130
Theoretical pI
9.38
Predicted MW (kDa)
231.0
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MSDQQKASLCPRLVDYMAIVGAHTTPPMPKGLQGLKAPPVQVPDLLRRYPPSDHADFPLPLDMVYFCQPEGCTSVGPRRT
GSAIRDMTSFVFALTDKDSGKTRYGICVNFYRPIERPSSAAGSAGAGNDRPGNGGPGGHGGGAGGGAGGGGRGGRRSSAF
RRESWRKSMERSSDSAFSRSNVAPSDSDRELTSRRDSDQQRLHSHHSHHQPHHPSASPAVPKLGLMAPSADSESGGSHSP
SPRASRKRTKLRNQSLTSLCIISHHPFFTTFRECLFILKKLIDACNESSSPKRVGASQKINRDNVWTVLTGHVSDATPSI
VLHDVREIETWILRLLSTPVPVPGSTRVEVEVLSPTVHEPLLFALPDHTRFSLVDFPLHLPLELLGVETCLKVWTLIMQE
NKVLFQSRDYNALSMSVMAFVTMLYPLEYMFPVIPLLPTCLSCAEQLLLAPTPFVIGVPASFLVYKKNFRLPDDIWVVDL
DSTKLTPPTGGYEEIPPLPEPEGTILKNHLKQALTSMTATNTAVSSQQLLPSVRDSLQEPPLLGVSQVRLPLQTPPHSAQ
ASQRNSMSAQGTISSRQPSPMNSPALNPFVYGTDVDSVDVATRVAMVRFFNAQNTLANFAEHTRTLRLYPRPVVAFQINS
FLRSRPRASQFLNQFARTQAVEFLAEWSLTPTNVAFLRVQTGVMDPMQVGDKPKWFAHALTPIRFSVWDDGSSLNGALRS
LKQLECQPTDESGSDSEGADSSSSSYSSLSDFVSEMASSDLSPSLHDVFGSYNRPHVVPQTLSSNLDPALVYHPPSKLQY
PEGIADAVASKEEEDEERADSPVSSSSSRSDLSSPSFNRDSEFDFQPKGGQTLGSTTVGSGAAAPSFELATPLAMRLEAT
IKMASIEQESDTVSTATGKTIAAGSKLQRHPSDSESRPEKKIPPPLTPPVKQPGVSNILARTGSSGSSSSSPGRQSSQSS
LFENFASHAKELVRETTRQSSQEGLLAHVDKHALDEDLDDKMRHTFEKFTLHAKKAAGEASKQALEVSKQAAGVSKNTLE
DLTYVGKSTLGDLTKTAKEAATKKGIIKIEEHSAGGAGPPPKSPGSQLATHKQVQQSGGQGGGNNFFSAIGTDFNGLASS
TSTMFSGMFGKKSQQKQVPVQQKQPNVSAGKAKSGINFDPFPGRKGLVERTPLIKHSGPRQTQEELTRQQNQERSHSNAE
NQTFLKDVTNQVLAGEGVGWLKLNRFKKLMEDESYRTLVLSKLNKTLDKKIAPDDHIDDVCVTKPVWKGMLKCIQAIAGG
LDVTFANFGLGGMASVFQLMEVAHTHYWSKEINEGSDMSSSLLSSHAASPMGSRENLRSPSSPNGSHSALGSEWASPQES
RKSSTQLAHGGPGGSHSGAPINRRLSSADSQDGQSTTEMFKDMLSQKRSALKNMLTSFDSDAAGSTGALSVVSLGVRLPS
SCRSTVSDTEYENTTTSKDSKKSSGNLWSGKSTLSAGFRYTGGHLINTSSSPSPDSPRVYLFEGLLGKDRLNLWNQMQFW
EDAFLDAVSQERDMIGMDQGPIEMMERYKSLSESERKRLEHDEDRLLSTMLYNLTAILVMLNVAKDEIRRKIRRLLGKSH
IGLVYSQEVHNVVDQINNLNGNDIDLKPLGSRLLHRQSFTVHQGTDVNGPLRFMEVRDDGLVLRSVDGTIVERWWYERLV
NMTYSPKTKLLCLWRRNGGQTQLHKYYTRKCKELYNCIKEAMERGGTPTNVPELGGEFPVQDMNTGEGGLLQVCLEGVGL
LFSNSKFFVRLDHIRKCFTQKGGIFVLEEYNPKTRNLIQRKYQSSMSDQICYSVLCVFSYVAAGQDQKKNPVVITPQIQD
IHAQQKQKHQQQQQHQQPQQQQQPHQTTTQQNQPTAVASAVPTTTAPAGQVNPNRMTAKSQAGSISIRHTVPMQKPTITM
STVQPQARMPAQVATASVPVTVPVPPTPAPPTSNPAKLPQLPPRVPSQPSTESLASISSPPPKLRTPMSAPPGPPPAIPP
RTGAISRSGSVPAARSFVRQASANSTPPQYTPQPPPPFVIPKRHSGLARASTLSSSTSPSMSSSSASNHPGHSQSQQRAS
HGSVAAVLQSMPEAEPGYGSGSGSISGSSSGSGSASGSIASASPQAHRKH
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0307208
8390
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0307207
8252
FBtr0307209
8372
FBtr0307210
5820
FBtr0330400
8459
FBtr0330401
8285
FBtr0346798
8285
FBtr0452146
8363
FBtr0452147
8459
FBtr0452148
6000
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0298036
2084
FBpp0298038
2124
FBpp0298039
1822
FBpp0303426
1819
FBpp0303427
2154
FBpp0312376
2095
FBpp0402896
2115
FBpp0402897
2147
FBpp0402898
1882
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
Rab3-GEF-PD
rab3-GEF-PD
Name Synonyms
Secondary FlyBase IDs
    References (0)