Open Close
General Information
Symbol
Dmel\Appl-PB
Species
D. melanogaster
Annotation Symbol
CG7727-PB
FlyBase ID
FBpp0298292
Associated gene
Length (aa)
890
Theoretical pI
5.31
Predicted MW (kDa)
98.6
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MCAALRRNLLLRSLWVVLAIGTAQVQAASPRWEPQIAVLCEAGQIYQPQYLSEEGRWVTDLSKKTTGPTCLRDKMDLLDY
CKKAYPNRDITNIVESSHYQKIGGWCRQGALNAAKCKGSHRWIKPFRCLGPFQSDALLVPEGCLFDHIHNASRCWPFVRW
NQTGAAACQERGMQMRSFAMLLPCGISVFSGVEFVCCPKHFKTDEIHVKKTDLPVMPAAQINSANDELVMNDEDDSNDSN
YSKDANEDDLDDEDDLMGDDEEDDMVADEAATAGGSPNTGSSGDSNSGSLDDINAEYDSGEEGDNYEEDGAGSESEAEVE
ASWDQSGGAKVVSLKSDSSSPSSAPVAPAPEKAPVKSESVTSTPQLSASAAAFVAANSGNSGTGAGAPPSTAQPTSDPYF
THFDPHYEHQSYKVSQKRLEESHREKVTRVMKDWSDLEEKYQDMRLADPKAAQSFKQRMTARFQTSVQALEEEGNAEKHQ
LAAMHQQRVLAHINQRKREAMTCYTQALTEQPPNAHHVEKCLQKLLRALHKDRAHALAHYRHLLNSGGPGGLEAAASERP
RTLERLIDIDRAVNQSMTMLKRYPELSAKIAQLMNDYILALRSKDDIPGSSLGMSEEAEAGILDKYRVEIERKVAEKERL
RLAEKQRKEQRAAEREKLREEKLRLEAKKVDDMLKSQVAEQQSQPTQSSTQSQAQQQQQEKSLPGKELGPDAALVTAANP
NLETTKSEKDLSDTEYGEATVSTKVQTVLPTVDDDAVQRAVEDVAAAVAHQEAEPQVQHFMTHDLGHRESSFSLRREFAQ
HAHAAKEGRNVYFTLSFAGIALMAAVFVGVAVAKWRTSRSPHAQGFIEVDQVGCQNVTTHHPIVREEKIVPNMQINGYEN
PTYKYFEVKE
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0307291
6331
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0070109
5422
FBtr0307292
5251
FBtr0307293
5425
FBtr0307294
6324
FBtr0307295
5425
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0070104
887
FBpp0298293
830
FBpp0298294
888
FBpp0298295
883
FBpp0298296
888
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
Appl-PB
Name Synonyms
Secondary FlyBase IDs
    References (0)