Open Close
General Information
Symbol
Dmel\Cadps-PD
Species
D. melanogaster
Annotation Symbol
CG33653-PD
FlyBase ID
FBpp0298334
Associated gene
Length (aa)
1534
Theoretical pI
6.02
Predicted MW (kDa)
172.6
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MIDPSSSEEEGEDDAVPNVSSKGRLTNTTKGTSAVSIIGGSAGSVVGSNIPVSGSNTDLIGNQRQSNISSICNRNDVGNI
SVAALGSTSNKIEQICGNRADTGNLEVPSNGIPSGISQETLNQSVGSSRANSLPRPLSPSPSLTSEKHETAEPHGKHERE
EEERKRRIQLYVFISRCISYPFNAKQPTDMTKRQTKISKQQLEIITQRFQAFLKGETQIMADEAFQNAVQSYHDVFLKSE
RVLKMVQSGASSQHDFREVFRNNIEKRVRSLPEIDGLSKETVLTSWMAKFDIILKGTGEEDSKRPSRMQQSLNSELILSK
EQLYDMFQQILLVKKFEHQILFNALMLDSADEQAAAIRRELDGRMQRVGEMEKNRKLMPKFVLKEMESLYVEELKSSINL
LMANLESLPVSKGNMDSKYGLQKLKRYNHSTPSFLKLILRSHGSLSKLEGDSEDGSTQLTKLDVVLTFQLEVIVMEVKGL
KSLAPNRIVYCTMEVENGEKLQTDQAEASKPMWDTQGDFTTTHPLPVVKVKLYTENPGMLALEDKELGKVTLKPTPLSSK
SPEWHRMIVPKNLPDQDIRIKIACRLDKPLNMKHCGYLYAIGKSVWKKWKRRYFVLVQVSQYTFAMCSYKEKKSEPSEMM
QLDGYTVDYIEAASANLMFGIDLNGGRYFFNAVREGDSISFACDDENECSLWVMAMYRATGQSHKPTPPITQDKNSAMSK
IQGDADKARKHGMEDFISTDPCTFDHATLFKTLQNLTLEYRLNDPYASLGWFSPGQVFVLDEYCARYGVRGCYRHLCYLS
DLLDRAEKQHMIDPTLIHYSFAFCASHVHGNRPDGVGSITHEEKEKFSEIKERLRQLLEFQITNFRYCFPFGRPEGALKA
TLSLLERVLMKDIVTPVPPEEVRQMIKKSLETAALVNYTRLSNKAKIDEDLRGDVIVPAPKKLEDLIHLAELCVDLLQQN
EEHYGELRKHDKMDKKKLLKEDEDVSGGHNESEVDLIDSTGLISASELATAASTDGSSFRYCMPTHAVYTPPVPTAFAWF
SDLLVEHAEIFWSLFAVDMDRVLSEQAPDTWDSFPLFQILNDYLRTDDNLRNGRFHQHLRDTFAPLVVRYVDLMESSIAQ
SIHKGFEKERWESKGINAALNPAALNNAAQALNTAALNPSMILCGKKDQVNFYVPKLPKQSNSTAANDEMRNGCATSEDL
FWKLDALQSFIRDLHWPDAEFRQHLEQRLKMMAVDMIEQCIQRTDSSFQSWLKKNIAFISTDYILPSEMCAMVNVILDAK
NQSFKLTTIDGIDLYKFHAKIDDQIDKANVAMTQGLSGKLMSVLESTLSKLARYDEGSLIGSILSFTNVSSSGKDLGQGY
VNFFRNNMDQVRGKIADDLWTLHFFEQWYSQQINMLCNWLSERVDHALHYAQVASISHIIKKIYSDFELQGVLEDKLNSK
AYQAVAQRMATEEATCALTMPDACEDEPCDEIREGEEEDNGDESTSNIPRGLPKPKVAAAQAAAVTNVVAGRVGNLLGKG
IGGLSSKLGSGSWF
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0307333
5584
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0091630
5569
FBtr0091631
5317
FBtr0307334
5413
FBtr0333702
5079
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0088329
1529
FBpp0088330
1445
FBpp0298335
1477
FBpp0305855
1409
External Crossreferences and Linkouts ( 2 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
Cadps-PD
Caps-PD
Name Synonyms
Secondary FlyBase IDs
    References (0)