Open Close
General Information
Symbol
Dmel\faf-PE
Species
D. melanogaster
Annotation Symbol
CG1945-PE
FlyBase ID
FBpp0300200
Associated gene
Length (aa)
2761
Theoretical pI
6.22
Predicted MW (kDa)
309.9
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MTFDTRRHTTGQPGSTAPSSSSSTTSTTTTTTSPAQSAGSGSGIGTGTGTVANSSLPGGGSGSLDGNQDQQPATDSQSSD
DVAASLSANSVDSTITIVPPEKLISSFPTTKLRSLTQKISNPRWVVPVLPEQELEVLLNAAIELTQAGVDHDCEPCVEFY
RNGLSTSFAKILTDEAVNSWKNNIHHCILVSCGKLLHLIAIHMQRDNPYLLDLLAIVFDPENKFNTFNAGRQPECFAAPD
YIWGQLDSNKMYARPPPEPKNARGWLVDLINRFGQLGGFDNLLERFNIGLELLKRNQNKCTGKNISVEGRVENGAQDNRL
TLALIHSLLRPFGQCYELLMPATIAKYFMPTWNVVLDLLDSFTDEELKREVKPEGRNDYINGIVKSARLLASRLTGQEEL
IRDLEMFRLKMILRLLQVSSFNGKMNALNEINKVLSSVAYFSHRSQPLPHCMPEDEMDWLTADRMAQWIKSSDVLGVVLK
DSLHQPQYVEKLEKIIRFLIKEQALTLDDLDAVWRAQAGKHEAIVKNVHDLLAKLAWDFTPEQLDHLFEAFQASMTTANK
RQRERLLELIRRLAEDDKNGVMAQKVLKLFWTLAHSQEVPPEVLDQALGAHVKILDYSCSQERDAQKTIWLDKCVDELKS
GDGWVLPALRLIRDICCLYDTTTNHAQRTQTSTNRQQVIERLQNDYSLVILVTNSLTAYMEKVRQMVTDSPGLDATRILI
DGRFPHHVQIAERLEFLKFLLKDGQLWLCADQAKQIWHCLAVNAVFPADREECFRWFGKLMGEEPDLDPGINKDFFENNI
LQLDPHLLTESGIKCFERFFKAVNSKEDKLKAIHRGYMLDNEDLIGKDYLWRVITTGGEEIASKAIDLLKEVSTALGPRL
QENIAEFHEMFIGECCSRLRTHYGNIVILGKTQLQEELDAPDQSDNTNDESKDSKMRFIEAEKMCRILKVLQEYVKECDR
SFSGDRVHLPLSRVTRGKNTILYIRFQNPGRSIDDMEIVTHSNETMAAFKRNLLKRIKGTSTANIKVDLFYANDEMIGVS
DEINPLYQYTIRDKMNLTAKLTPVGTGLASSPDSSSDSSTGSPPRPCPDMQRVESESTLPGVIISQNYQYTEFFLKLYQL
GSDLEHGRLRDSAKVLLHLLPCDRQTIRQLKIMCKVPKAAVTVAVTGDKIAKDEEEKLYPTEQAGIEDEEEHCTPEQMFL
HPTPAQVLYNLSVLHGLLIPALDPLGESALLVQSAWMHSGCAHFVLELLTKNNFLPSADMHTKRASFQCVLRLAKLFLYI
VGSVLSRVGDEPMICDLDNGSRSQVDILKQNFSTMPSSSQGTLRAISAKLAVILAREMLSASPEGDRCRTLFSSTLQWSC
PDISTIKAVVQLAWASSCGNLQALGNSSGDFEDEVIVPDGQDFSMCKEALEVLTISFILNPSANEALTSDPNWPKFITSI
VLKNPLRHVRQVASEQLFLASTYCAGDRRPFVYMVNLLVGALKTLVPQYESTCAEFFSVLCRTLSYGCIYNWPLQISEGL
LGDEIKWLQRIRENVHATGDTQVHEELLEGHLCLAKELMFFLGADSKAQLNELIHELIDDFLFTASREFLHLRRHGSLRQ
DTVPPPVCRSPHTIAAACDLLIALCQLCVPNMKLLTNTLIDFVCTDTDPLREWDYLPPVGARPTKGFCGLKNAGATCYMN
SVLQQLYMVPAVRVGILRAHGAATTDGEDFSGDSDLTGGGLGSALFSGPASALVSLPSSSSTIEDGLHDVRKNYHVVILK
HVQAIFAHLGHSALQYYVPRGLWTHFKLLGEPVNLREQQDAVEFFMSLLESLDEGLKALGQPQLMNATLGGSFSDQKICQ
ECPHRYSKEEPFSVFSVDIRNHSSLTESLEQYVKGELLEGADAYHCDKCDKKVVTVKRVCVKKLPPVLAIQLKRFEYDYE
RVCAIKFNDYFEFPRILDMEPYTVSGLAKLEGEVVEVGDNCQTNVETTKYELTGIVVHSGQASGGHYFSYILSKNPANGK
CQWYKFDDGEVTECKMHEDEEMKAECFGGEYMGETYDNNLKRMQYRRQKRWWNAYMLFYTRCDQTPVQYEPSVEQLSLAE
SRNMVLPLPKPIERSVRHQNIRFLHSRSIFSVEFFNFIKKLVSCNLLSARSNKITPAAEELSLLGVQLASQFLFHTGFRT
KKSLRGPVMEWYDALSHHIRSSALVRKWFANHALLSPPSRLGEYILMAPSPDVRTVFVKLVVFFCHFAINDEPLTGYDGA
NLCEQVLISVLRLLKSEAADYGKHLPHYFSLFSMYVGLGTREKQQLLRLNVPLQFIQVALDDGPGPAIKYQYPEFSKLHQ
VVSHLIRCSDVSEKCQSSNQNARPLSNPFKDPNVAHEELTPLSTECMDLLFNRTGYIKKVIEDTNVGDEGLKLLQYCSWE
NPHFSRAVLTELLWQCGFAYCHDMRHHTDLLLNILLIDDSWQHHRIHNALNGVAEEREGLLETIQRAKTHYQKRAYQIIK
CLTQLFHKSPIALQMLHTNSNITRHWSIAVEWLQGELDRQRGIGCQYNSYSWSPPAQSNDNTNGYMLERSQSAKNTWSMA
FELCPDEVSEKTDENNEPNLETNMDENKSEPVAQPGGVLEGSTGGTEQLPENKTPTTSSPSTAAWPARGDSNAIPRLSRQ
LFGAYTSTGSGSTSGGSAPTSALTTTAGSGANSETESSAQETTGETTINGLTNSLDQMEITAKKGVRSRSKGGKLPPVLF
HHHQLPPEQQLKLKQQQQQQQQQQHQQLRGDINKTSSSRLI
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0307548
9411
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0085843
9194
FBtr0085844
8682
FBtr0307547
9163
FBtr0307550
9837
FBtr0339188
9179
FBtr0339189
9379
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0085202
2778
FBpp0085203
2711
FBpp0300199
2773
FBpp0300202
2773
FBpp0308326
2773
FBpp0308327
2761
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
faf-PE
Name Synonyms
Secondary FlyBase IDs
    References (0)