Open Close
General Information
Symbol
Dmel\Tomosyn-PI
Species
D. melanogaster
Annotation Symbol
CG17762-PI
FlyBase ID
FBpp0300333
Associated gene
Length (aa)
1470
Theoretical pI
7.05
Predicted MW (kDa)
158.5
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MKKFTFKGVLDGFRQSVQPQATRQEQEIQEQLKADHFTLKKTFRHGFPYSPTSFAFDPVQKLLAIGDKSGYIRILGRPGV
DAHAKHEGESECAVLFAQFLVNEGALVTVTADDTIHLWSIRQKTPRIVQSLKFQRERVTCIHLPVGSKWLYVGTEKGNIH
VVHIDTFALSGYIINWNKAIEVVRTSHPGAVIALCDNPLDANKLLIAFECGLLVLWDLKAKCAELRWQAAEAVKSLAWHY
EGKYFVSSHTDGSICSWPTKPQAKPQSQVCPHAKINKDGNAEKCKPIYKVDLKSSATGETFTIFSGGMPSEKGSKSNCIT
VMVGKATTVLEMEHAVCDFITLCENPWPCETQEPYAIAVLLQYDLVLIDLLTPGFPCFESPYPMDLHESPVTCCTYLTDC
PSDLVPAFYSVGRTTTSKKSCFSEREWPISGGEWSPASCSYSEIVITGHQDGSLKFWDSGAGTLQILYKLKTAKMFEKPR
SHVAHSHPESDNPLAVHLIFLCSESRRLCVAGAMGQVMLFKFRKVESTSEVLVLEIPILYENFDDIYGTSPECDFLTGHQ
VQKAESSDSDKTAECSLKVRNGAQRKPPGFQSQLVCLTTGPNRRNVQVTSLCISSSYGLMAYGTEYGLVIIDIIQKICLL
SVACPDLYGAHDPYSRTPKSPKRIENKEEQSRSPSSDQLNDTTSPDSPSLEFVPEAGETSAHDGVATATSSRPSSPDPVV
NSARETLLSGSAAATAAAAASAAVMMAKSPQRDDAAPKELQDRRKSMSWKTFNLKRQLSKVNMKIGGLNVNTDMESLKNS
SIFYTPKEVSPEAATPPATEEEATPEGKEDESLDDGEMATNAGAAAAASPSPAVRGKFRSSTTDSPDEGASSSIASGIRR
VDFEQPAGVEVERPNNLPLADAPAPLKPARQKFKEKSRDQRLLSVPNIKYQPRDSRGGARNLKNDVSPLMGGGGGGGGVV
GASSGIGGSVAGGKKIHKLDGTFSRSRSSSMSSIDMSSSESVTCLAFIESYAKRNDILTLVPTLWIGTSFGSILTLFITM
PERDVRKSQPVLITINGGPVVRLKGSITSMSFLDSYGSIIPYTFETWRDEKRDNKDRTPTKSSSRTSPTFTPTTANTLSN
TSVAGGASAGGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGVTSGGGMSSSSASSSGISGSVSTGLET
LTDRQYIVIASEKQTKVFDVANQCCINRIQLSEMDFAVKAETITMKDGSCLATYLSNGHLMVHSLPSLKLLLDTDFLPLM
ELSFQTKCKQGIVDPMLSIWGQQIIVHEDTTQISKIFCFSHKGHGLYMASPTEIQKFTISSEFCQFILEMMGELYTVHEM
PEQPKEGFFKGLFGGGAKLLDREELFGEQSGKPNRSVARHIPGPNLEQLGQRASTAASEISRAHQLAMERGEKLNLLEER
AERMANTAQDFSGTAHQLMLKYKDKKWYQL
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0307899
5330
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0073678
5490
FBtr0300375
5290
FBtr0307898
4541
FBtr0307900
4687
FBtr0340406
5041
FBtr0340407
5062
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0073511
1470
FBpp0289604
1470
FBpp0300332
1254
FBpp0300334
1254
FBpp0309352
1387
FBpp0309353
1387
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
Tomosyn-PI
tomosyn-PI
Name Synonyms
Secondary FlyBase IDs
    References (0)