Polypeptide Dmel\Crk-PE

General Information
Symbol	Dmel\Crk-PE	Species	D. melanogaster
Annotation Symbol	CG1587-PE	FlyBase ID	FBpp0300576
Associated gene	Dmel\Crk

Length (aa)	263	Theoretical pI	4.86
Predicted MW (kDa)	30.2

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MDTFDVSDRNRQDATEVLMNERERGVFLVRDSNSIAGDYVLCVREDTKVS NYIINKVQQQDQIVYRIGDQSFDNLPKLLTFYTLHYLDTTPLKRPACRRV EKVIGKFDFVGSDQDDLPFQRGEVLTIVRKDEDQWWTARNSSGKIGQIPV PYIQQYDDYMDEDAIDKNEPSISGSSNVFESTLKRTDLNRKLPAYARVKQ SRVPNAYDKTALKLEIGDIIKVTKTNINGQWEGELNGKNGHFPFTHVEFV DDCDLSKNSTEIC
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) Crk-RE FBtr0308256 1173
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) Crk-RA FBtr0089113 1197 Crk-RB FBtr0089114 1143 Crk-RC FBtr0089112 1122 Crk-RD FBtr0304871 1357 Crk-RF FBtr0334406 863
Other Polypeptides
	Name FlyBase ID Length (aa) Crk-PA FBpp0088182 271 Crk-PB FBpp0088183 253 Crk-PC FBpp0088181 271 Crk-PD FBpp0293411 184 Crk-PF FBpp0306509 104
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_001245411 DDBJ / EMBL / GenBank • AFH06771
Synonyms
	Crk-PE
References ( 1 )
FlyBase analysis	FlyBase Genome Annotators, 2004, Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. [FBrf0166453]