Open Close
General Information
Symbol
Dmel\Ctr1A-PD
Species
D. melanogaster
Annotation Symbol
CG3977-PD
FlyBase ID
FBpp0300818
Associated gene
Length (aa)
241
Theoretical pI
6.69
Predicted MW (kDa)
26.8
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MDHAHHSAPGVDHSMHHDHVGMHHDHSGIPAATASPMDAASMFDLIPDTSDLQASHAGHAAHGAHNHGGGSGTGMEHMMP
MAFHFGYNETILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYYREYLFWKTYNLLEYRPVTGPQRNPEAPRIPSPAAAA
PSPVQYVGEVVHKQPPSMLSINHLLQTLLHVLQVTLSFLLMLIFMTYNVWLCLMVVLGAAVGYFLFCWKKSVIVDVTEHC
H
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0308594
1503
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0070951
2103
FBtr0308592
1575
FBtr0308593
1601
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0070912
231
FBpp0300816
231
FBpp0300817
241
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
Ctr1A-PD
Name Synonyms
Secondary FlyBase IDs
    References (0)