Open Close
General Information
Symbol
Dmel\CG40498-PI
Species
D. melanogaster
Annotation Symbol
CG40498-PI
FlyBase ID
FBpp0301021
Associated gene
Length (aa)
268
Theoretical pI
8.65
Predicted MW (kDa)
29.9
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MHSVGIHSAMAIKRQRKRRDEQKRARERRYSTQSSESGETFHSPTGSVRRKYHHPRNAVSSGTGMLDSQVVTSIGMLHIG
IVFVVFGVFLCGAGIIPDETMSWNVFSSSSAWWNEVTCTGLFSLGLGLFLLILNCLISRKEEEDLEDYVQRQLTRSRSGH
RLERDVETGVLTTRHARKAVALQKGGRNNSPTDVSVVNCGSSENMSNGTIVSHNVLNSSDAILEKIVEEDNTYLNDRSSG
ISPIDLENDKKLLLRRESLNDAISITRI
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0308894
1443
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0302340
1605
FBtr0308892
3210
FBtr0344186
1681
FBtr0344187
1439
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0291544
268
FBpp0301019
268
FBpp0310598
268
FBpp0310599
268
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG40498-PI
Name Synonyms
Secondary FlyBase IDs
    References (0)