Open Close
General Information
Symbol
Dmel\CG9492-PF
Species
D. melanogaster
Annotation Symbol
CG9492-PF
FlyBase ID
FBpp0301058
Associated gene
Length (aa)
4700
Theoretical pI
5.98
Predicted MW (kDa)
538.7
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MFVQKKKLVEHVLAMRAEGGSSDDDDEEEDQGDILQRRREECERKARRGEMDPRLEFTFQLLIDATQLPRHQLMDYIFEG
DMLDEINQLFLPNMKNKLLWFYQETDDPEPTPVPDPNKPGPSRSGVASSSSKTPQGGASPSGMPPPKHKKLFLTDGWTCA
FTGVCIYIFRVNTSKQLPEEGFQKDLYCGVIDAKNIGLVTSIERIVEFVFMQALAFPSLEGDEEDVSCGLIKGQLLPGLR
SFCSALRVCEQVCDHHNVFADGCDMFEKIDAVEEVKDMSKNQEFCAQLEERVNNWTKGILKILGESEQLRKENDHSGPQD
ELEYWKKRGAQFSQLLAHLQDKEVQFTLHCLFLAGSRIIKQWKETDRKITFCYNEARDNSKFIQAMETCCHSLYLDDPVS
MKESILSLLQTVRLIYSVSQFYNTSERTSALMVKITNQMIETCKSYITCRCKETIWSQDRNVIRTKLSNCIKLNHIYHET
YYTVREQPFLPNQTPFGFSENFVFGKFDTFCERLSKIISMFNLIDDYNHLFERRLEGLLLGEALEDASNHFEEAKKEVTS
RKYDYLDHRNSDFNIDFERFIHKTNSLKDTIATLIEKDFDTVWETPQCIRFLVRFEKVSEKIPLTRMDEKYTRILRYVEK
EVDRILKTFRKQRDDPPLARNFPPIAGRIHWCRALSLHITELMDAVMEHVVLSSLPMAKDLDVRYHNVLGILQEYEDEIV
SIWLDQDVSVADACLLQPLLSLQGDKLFVNLHPTIPLLIREAKMLAKLDIELPIVAATLMSRQQYFITIQDSLNCLIKMF
LSTVRAVKLEVRPLFLPQLVRLTAMLKPGLHTINWTNQNWTEFYERCKQAIESFDVLVARVHDIYSNRILHVLMWMQDVS
LQILPADDEIWTVDEFLERSEEACRKAAIELNRKSQMVSEAVEEVLSLVDRATAAFKEIAGDDVITLFDAATPKGDNSGS
GGRKPEDGGGGGGGAAAPSTSGGGGGGQQQDWSILWSCFENPLSLLSTTESLPKGMQDMVCNAVVEMRRYYSRKVIDVLI
KVIRAALDTLRRRFIADENETVFKKPVFALHAQLQIPHVVIKPNLDELQDILVTAGKNITGIAKGVAQWSSGKDPPQVSM
TVQPRVGRNHNESTGGGKSRRRKIYCLASEERPQMPHMLKSFYSAIMDNKEVAKAVNQLASCTKNVKPEIQTYIKRWKPY
HFLWKNDRTTRQLMEFGLQEFETTLRCLSDLDANLLVEPDMEVFGQCVAVYNEKLKYGLAIEIKSCNHKIGQAMKKKYKK
EMDYVYAVINEMDRKLDRPIRDLDDVRMIMETLGKIREQEVDMELRIDPIEEAFNVLTRYEVQVEREQFDLVDNLRATFQ
NLLAGALQAQVKLLDMQPAFQDDLRTNLDNFKQDKISYVTEYRTAGPMQAGLTPREASDRLILFQNRFEGMWRRLQTYQS
GEELFGLPQTDYPELGQIRKELNLLQKLYKLYNDVIDRVSSYYDIPWNEVDIEEINNELMEFQNRCRKLPKGLKEWPAFH
ALKKTIDDFNDMCPLLELMANKAMKPRHWQRIMDVTRYIFEFDSEGFSLKNILEAPLLKHKEDIEDICISAMKEKDIEAK
LKQVTNEWSVHELQFMSFNNRGELLLRGDTTAETIGQLEDSLMVLGSLLSNRYNAPFRKQIQQWVYDLSNSNEILERWLL
VQNMWVYLEAVFVGGDIAKQLPKEAKRFSKIDKSWQKIMQRAHETPGVVACCVGDDLLKQLLPHLQEQLEICQKSLSGYL
ERKRMMFPRFFFVSDPALLEILGQASDSHTIQNHLLNIFDNTKSVKFHDVEYNKMMAIISSEGEMIQLDRAIRAEGSVET
WLTQLLVTAQASLHSIIRTAYATINDPNFTLLSFLEKAPAQIGLLGIQMVWTRDAEMALMRGRERKVMMETNNKFLEMLN
TLIDQTTRNLTKRERTNFETLITIHVHQRDIFDILCRMNIKSANDFEWLKQCRFYFKEDLDKTWISVTDVTFTYQNEYLG
CTDRLVITPLTDRCYITLAQALTLSMGGAPCGPAGTGKTETVKDMGKTLAKYVVVFNCSDQMDYRGLGRIYKGLAQSGSW
GCFDEFNRIELPVLSVAAQQVAVVLTAKKEKRKTFLFTDGDTIEMNPEFGIFITMNPGYAGRKELPENLKIQFRTVAMMV
PDRQIIIRVKLASCGFLENITLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAAKRRNSKDTESTIVMRVLRDM
NLSKLIDDDEPLFMSLVSDLFPNQTLEKTNYPELEAAILQQTDEASLVYHPPWVLKLIQLYETQHVRHGIMTLGPSGAGK
TTCIHTLMKAMTQMGDNHREMRMNPKAITAAQMFGRLDVATNDWTDGIFSALWRKTLKLKAGEHVWLVLDGPVDSIWIEN
LNSVLDDNKTLTLANGDRLTMAPTVKIIFEPHNIDNASPATVSRNGMVYMSSSGLDSRPIVQAWLKNRAPGEKSTFSDLF
DQTFVEVYNWGVQMVKLQMPVLQCNIVQQMLFILEGLIPVKKEDEQAVSMSSKESHDEDLPPETSIEEKEDTCTPEHLHR
LYIFALAWGLGGYLSTSDRQRMNLFVKESFPQLDYPKGSAHENTIFDFFVSPAGVWQSWKTLVTPYMYPELSTPDYLSIL
VPIVDNVRIDYLIGTIANQERAVMVIGEQGTGKTVIMKNFMKKMNVESYMGRSFNFSSATSPYQFQRTIESYVEKRVGVT
FGPPGGRKLIVFIDDINLPEINEWGDQITNEIVRQSMDMKGFYSLEKPGDFTTIVDVQYVAAMGLPGGGRNDIPSRLKRQ
FCVFNCNIPDNDSIDKIFRVIGEGHYNAKRGFVPEIRSLVKKLIVVTRHLWQRTREKLLPTPAKFHYVFSLRDLSRIWQG
MVGTLSTVITSESVLMALWKHECTRVFADRFTTFQDKEWFGSELACLVREELGDSHSQMILPNPVFVDFMRDAPEPTGEE
GEDTDMELPKVYEPVHSHEVLRERLVMFLAQFNEMVRGSGMDLVFFPDAMLHLVKISRIIRHPRGSVMLVGVGGSGKQSL
TKLASFIAGYKTFQIALTRSYNVANFLEDLKLLYRTCGVQGKGTTFLFTDMDIKEEGFLEYLNNILSSGVISNLFSRDEQ
AEIVQELTPVMKRENQRKTATPESVMDFFLARTCTNLHVAFCFSPVGETFRSRVQRFPALVSGCTIDWLHPWPKDALVSV
ARHFLSHFEIECTPAVKEELVNALGSIQDIVAETSQEYFQRFRRATHVTPKSYLNFIAGYKNIYQMKQQELRDGVEKMDT
GLEKLKEASASVEILKKDLVVMEEELVEASKNAESVLVEVTERAMQAEIVKNQVLIVKDKAEALVACIAHEKALAEEKLE
AAKPALEEAENALNTIKPAHIATVRKLGRPPHLIMRIMDCVLILFKRKLHPCIPDAGTPCPKPSWQESLKMMASATFLLQ
LQNYPKDTINDEMIDLLQPYFRMEDYNMDMARRVCGDVAGLLSWTKAMSFFHSVNKEVLPLKANLTMQEARLKLAMDDLA
GAEEQLREREEALQAVKDQYDKAVGEKQRLTDAANVCLRKMTAATALINGLSDEKHRWTNQSKEFKIQLGKLVGDVLLAT
GFLSYCGPYNQEFRANLIKTWMGILKQKNIPFTTGLNIINMLVDSSTVSEWTLQGLPNDELSVQNALIATKSSSYPLLVD
PQTQGKIWIKCKEDRNELQITSLNHKYFRTHLEDSLSLGRPLLIEDVGIDLDPVIDNVLEKNFIKSGSIEKVLVGDKECD
VMPGFMLYITTKLPNPAFSPEVSAKTSIIDFTVTMRGLEDQLLGRVILMEKSDLEAERVALFETVMQNQRNMKELEANLL
LRLSSSQGSLVDDEALIEVLRVTKTTAEEVNQKLKISEVTERKIMKAREEFRAVAKRGSILYFLIVEMSNVNAMYQNSLK
QFLVIFNHSITKSTKSSVTEERINIILRYLTYEVYKFTNRSLYERHKQLFTLMLAIKIDYHNGNISHEEFLTFIKGGASL
DLNAVTPKPFRWILDITWLNLVEISKLETFSTVLQVIELNEKDWRCWYECEKPENEEIPCGYNAILDGFRKLLLIRSWCP
DRTISQAKKYIEESLGPEYSEMQILDLEEMWLESEPRTPFVCLLSIGSDPTTQIGALAKQKSIVLKSVSMGQGQEYHARK
MIIESMAIGGWVLLQNVHLSLPFCSEIIDMLVESEHIDDSFRMWVTTEPHNEFPIGLLQMALKFTNEPPQGIRASLKRSY
QSFTQDFLDYTSATQWPPLLYTVAFLHTIVQERRKFGPLGWNIPYEFNQADFAASVQFIQNHLDEMDPKKGVSWQTLVYM
IGEVQYGGRVTDDFDKRLLTTFTSVWFCEPLLSNSFEFYKGYKVPGTKSLQGFIDYINSLPAYDTPEVFGLHSNADITYQ
INSAKGILDTILSVQPKEGGGGGGETRESIVYQLADDMLRKLPAQYNAYEVRENLTRMGILLPMNIFLRQEIDRMQRVIK
RVHTCLCDLKLAIDGTIVMSPALKESLDAMYDARIPETWMKISWESTTLGFWYTELLERNGQFRTWISTDRPKVFWMTGF
FNPQGFLTAMRQEVTRAHKGWALDSVVLQNQITRYNKEDITEYPTEGVYVHGLFLEGASLDRRSGKLIESKMKVLYEQMP
VIYIYAINTTAGKDPKLYECPIYRKPQRTDLKYVGSIDFETEFNPKHWTLRGVALLCDIK
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0309029
14494
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0309027
14542
FBtr0309028
14470
FBtr0344344
14566
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0301056
4716
FBpp0301057
4692
FBpp0310725
4724
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG9492-PF
Name Synonyms
Secondary FlyBase IDs
    References (0)