Open Close
General Information
Symbol
Dmel\ogre-PC
Species
D. melanogaster
Annotation Symbol
CG3039-PC
FlyBase ID
FBpp0301607
Associated gene
Length (aa)
362
Theoretical pI
9.08
Predicted MW (kDa)
42.6
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MYKLLGSLKSYLKWQDIQTDNAVFRLHNSFTTVLLLTCSLIITATQYVGQPISCIVNGVPPHVVNTFCWIHSTFTMPDAF
RRQVGREVAHPGVANDFGDEDAKKYYTYYQWVCFVLFFQAMACYTPKFLWNKFEGGLMRMIVMGLNITICTREEKEAKRD
ALLDYLIKHVKRHKLYAIRYWACEFLCCINIIVQMYLMNRFFDGEFLSYGTNIMKLSDVPQEQRVDPMVYVFPRVTKCTF
HKYGPSGSLQKHDSLCILPLNIVNEKTYVFIWFWFWILLVLLIGLIVFRGCIIFMPKFRPRLLNASNRMIPMEICRSLSR
KLDIGDWWLIYMLGRNLDPVIYKDVMSEFAKQVEPSKHDRAK
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0309873
2158
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0071036
2161
FBtr0071037
1802
FBtr0309874
2794
FBtr0309875
1689
FBtr0334881
3068
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0070995
362
FBpp0070996
362
FBpp0301608
362
FBpp0301609
362
FBpp0306903
362
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/Swiss-Prot - Manually annotated and reviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
ogre-PC
Name Synonyms
Secondary FlyBase IDs
    References (0)