Open Close
General Information
Symbol
Dmel\Ca-β-PL
Species
D. melanogaster
Annotation Symbol
CG42403-PL
FlyBase ID
FBpp0301962
Associated gene
Length (aa)
844
Theoretical pI
7.13
Predicted MW (kDa)
95.5
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MVQRASSSDAPSVQGGQHRESRFGLGYPSYQSGYNKLFTQGSADSNYSQPSSDLSLDEEKESLRREKERQALSQLDKARS
KPVAFAVRTNVAYDGAIDDDSPVQGGAVSFEIREFLHIKEKYDNNWWIGRLVKEGCDVGFIPSPAKLDNIRMQNQTRPSR
LYGTKGSSSGNLGAGGQAGAEPSRGSTPPTPGDESDSMGPGRHGKTPAAAANKEKRKPFFKKQETASPYDVVPSMRPVVL
VGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVMADISLAKRSIMNNPSKRAIMERSSSRSDCLGKVQEEIERIFELA
RSLQLVVLDCDTINHPSQLAKTSLAPTIVYLKISSSKVLQRLIKSRGKSQAKNLSVQMVAAEKLAQCPPDMFDVILDENQ
LEDACEHIAEYLETYWKATHPDIRAVPPIARPLPQEASPSADPARLGPTPPVDGEEFVDEQDPRMGMSGGDREGSRERDR
DSRERERERERERDYWDREFNRDRSSKDRERDLEWERERAREWERERERDWDREFDWDQGGTSYQHSRRQPTSVRHQERG
GGVGAGGGGGGVGGGYERDRERERYERRERDLMHYDLNSDELLDERNFEYPAMRSGPSGASHHGHLSRGGRLLEDPDFER
EEAQMRMSSSRYGPSTRIDDPRDLPRGATVVDRDEYSPHRGGGSSRRMLNAMSRPLGLPRQSSLPSNRAPVSYLPRQSSL
GTHWLSSSSQSNLDQGPQSRRELYPLLHQPQSYSQPRSQYTSHSYTSAPQHTSQSRSQSQSHSQSHSQYRYSVQDTSFAH
PPRSLREEFLSPTMSKVEAVTHAIRNKIIVEEDEEDILSTDRFY
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0310279
4514
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0300536
3739
FBtr0300115
4963
FBtr0306386
5788
FBtr0310280
5025
FBtr0310281
4461
FBtr0343615
4982
FBtr0343616
4530
FBtr0343617
5400
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0289763
432
FBpp0289392
817
FBpp0297478
733
FBpp0301963
682
FBpp0301964
455
FBpp0310210
439
FBpp0310211
466
FBpp0310212
745
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
Ca-β-PL
Name Synonyms
Secondary FlyBase IDs
    References (0)