Open Close
General Information
Symbol
Dmel\htk-PD
Species
D. melanogaster
Annotation Symbol
CG34422-PD
FlyBase ID
FBpp0302588
Associated gene
Length (aa)
2486
Theoretical pI
9.46
Predicted MW (kDa)
259.5
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MQQMDDPPSLPVGTEVSAKYKGAFCEAKVSKVVRNIKVKVAYKQGLGSGIVSDDAIKAPTGQLRVGAVVEVRHPDRKELV
EATITKIQDCSQYTVVFDDGDITTLRRTALCLKSGRHFNESETLDQLPLTHPEHFGNPVVGGRRGRRRGHLNEDSSEDDD
ESDAKEVVNEKEENIGKVVCVETESKKKDKEKWFPALVVAPTAQATVRIRVKDEYLVRSFKDGRYYTVPKKEATEFTREV
ASKQDVPAVQAALEFLDSSVLPAHWDRDSLFGLTNISSDDEGEIDSDSSDDEPHEEKDRFVAQLYKYMDDRGTPLNKVPS
ILSRDVDLYRLFRAVQKRGGYNRVTSQNQWKLIAMRLGFTPCTVSVMNLVKQAYKKFLQPYGDFHRKLGCSMLMTSRNSN
RSKGRSLVRANSVASPKPMETMKTETISKLAQPNQTNVVASTSSSAAAASVAASSTPARAVSTASQSAAEESGNTSESSV
VVEPPKKQRKGSAASSQQGKVKSLVEKYEEKSTAVQATSSGTVAGSGASASAAAMPTTSAAASTATNLSSATSGGSATIA
TTAMNKDAESDLPLAKIKAAAVAAASTRHSMEKETNISSGSSASASSKANSAEMQRSRDASPSVAAPPSAGASTSGAAAT
AQTASNKKEKHQRSKQADKEKDKDKEEKQASSGKRKKEKISVEKIDTGDFVVGIGDKLKVNYHEKKSPSSHGSTYEAKVI
EISVQRGVPMYLVHYTGWNNRYDEWVPRERIAENLTKGSKQKTRTISTSSANSGSGGGGGGGGGGGGGGGGGGGSLLVQG
SQPPGVSDKQPGKDGCSKMSPSSGNSTGPGAPSLSGSLGGASSTPSLLSTVVKTPPTGGAKRGRGRSDSMPPRSTTPSSV
VAHSGRTKSPAASQPQLQQQMKKRPTRVVPGTTTPRRVSDASMASESDSDSDEPVRRPKRQSAKDKPQAGKAQPPGKGRL
ASSASSTAPAAHPSDDSEEDEEEEEPSAARAASSKQQQQQASSLRGSRAGGNRAMSSGAASAKGRDYDLSEIRSELKGFQ
PKLLTNAASNEERKDLAKKEPSDEPALQDIKKEPKLESSAKSSSTELSSETESYADEDSQSSDYRKQLKGSGAGKKEPTA
SPSKLHHEPVTKRELAVKEEPLKIEPKTEPKEEETKSKPFLSGADIKPTALIAPARFGNTSAAQAASSSGSSSTTAKYTS
VIVEKPLTIGGKKSVEQHVPKKAELLKKQSGGAGGTAASSSAASQESKKFAEPVASLKVEMPAACSPSSSSSSSSSFCST
GSAVSSSSATRSLPDMSKLEISSGTVPGATPGAAALQPSNVAQVSSSGAAKESKYSSSGGAAAGSGISMRKLLSSDVYEF
KDTEPFEFEKRISPMASVGGTVAAAATAAGAMAAAGAASVITTMVPTPGASGSGVAASASTSAPVVVGSAARKQALKASA
IQHILEHQSPAAGRERGGYGGMTSSISLLTAPKLKKRGSPLKEAALCMEKAKTYKLDKDQVQQPVEQKTQQLIQPTLGPV
ESYGAGSPEAMSNLSTPTTSSGHAQLSASSTYSQLTPHHATPFDALRKSPSFNLNITALNEELAQTVQETTRALTDALQP
PSTPVPPTVSASGSTPTAVTPVITAMPTAGTAGLSCPSTPPTGANPVLASPKLSTPPQAINASKQPPASHIVGSPFIETR
NVFELSTSNEGSGYSSGESKDNKFEKLENVKILLAGAVGPFDLDAGSYEQKTSSIADKVLKAISQKKEEVENNKGKPPVE
PAAAAKTPGREDVVPSPTAKLDLCSSAIKLDTLKLLSEPLKIQTGPLLGELYRPGPATSSPETKSILESSLPAKNSELSE
TIQKLECAIQQRKTPVGGALSLASSTAGTPPTAHTPNSTATAGAGFSDESMDSTDSEQRLVIEDVIAEEHTTTTTTGEQK
SPGSQQEEGQTNTATMATAVTAETEGTSSSTPTPPVPAPVKLELGAKAMPGIQAPIPLKPAEGSSFAGKLTGVVQPPPLA
KLQQQEELGQAQGQSKSISSFGIPIVLPEIPASVVVATPALMVASAATVMRHSPGSTPNSQAPVLISPKTFLTAPKVGEV
GGLLLKAYTGVSGAVGAAPAGSVIASAGGGGTPTVISNFPQQQQQASVLQASSEMPANYVLDAEMAEPSNSSAPVVARPF
VMHAVGKELFNVVAPAASSPLISDPHNESINLLCEETIPGSPAPNYGGTDQLPTAVNSALAIVGITPLPPDTPPPVPVAA
IQQQQQHQLQSGQQQQAAKTGEVNPSGPNSSPDSASQDESGEEAKKNAGLEHEDSTGLGALNKRKRNRKPLPMSAQTAAA
VAAQLQSLGKRRRQVSGMRNQKTTTTAAGSDTDDNSDNIAPNAGQQQQQPRQSARQHMMPQSNAQQQQQQQLLQQQQTQL
PQGIQSTNSSGVRPCPYNFLVELDPALSSDECITILRKQIQDLRKAYNTIKGELAVIDRRRKKLRRREREKKQQQLQSQQ
QGKICA
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0310440
8079
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0310365
5984
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0302046
1864
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG34422-PD
htk-PD
Name Synonyms
Secondary FlyBase IDs
    References (0)