Open Close
General Information
Symbol
Dmel\kmr-PG
Species
D. melanogaster
Annotation Symbol
CG34383-PG
FlyBase ID
FBpp0302931
Associated gene
Length (aa)
2042
Theoretical pI
9.04
Predicted MW (kDa)
227.4
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MFGCIYQLWDWLEAPPLFTAGTMDAKKLQQLQEAAILAQQQKKLPLAYQTNLVDYRTAAYSQALYQQSPTATSSSGGGPL
SPIDMQPQSKHYNLMKHGGGTSSSSHSSPYHQSYSSSGGTAAGEQLYQSPTERTYLAAAGRLHANNAMAGHHPISALQSQ
YQQLQAAKMQAQMATQSEAAQQQQRTFALRQAMNPPTNHYHMSQSSSMVSTMTALNQQQQQQQQQQQQQQQQQRAPPSSL
NLQNQYQPAQGPLKLQQQQQQQQQQSQQPAMPKHYQEQLYAQQQQLQQQLHQQQQQQQQLQQQQQQHRHKNDLQTPGSEH
GTVYIQQNHPNHVVNQACQTQISAVKPKATPSSEESSSNSTKSPSHAPLDRKKSAGSIQALKSPITKRPPSTPVTLSGWL
HKQGSDGLKVWRKRWFVLAEYCLYYYKGPEEEKLLGSVLLPSYRVSACLPEDKIYRKFAFKCEHQNMRTYWLAADNSEAM
MQWVRALAAASLMQAPSSGESEPSVNSSLNHSGENSDSGIHTLQSHPGKGQPTPSSENTGSSGGGSGSGQPLYANAPPKP
RRINDGGYSSPSPEHNEQQQQHPSRRLMSPTQQLYQQQQHQRSQQQQQQQPQQHHAIYDTRTGHVSTALQLQQAQQQYSL
DHLEAQFQQQQLDMEEQIARLQQQRAAEEIYGEREMYMAKLMQQRQGPNGTYPTQQQLLQAERRTPDAYGRSKQQRLFAA
AAAAADYEDIYNMSQLAGGGGVPMSAQEALLQEAASYRRPLSPPSYDGSKHVPAMPQRYTPNHLEASAADQLINTMDLRA
RTAAAIVRPHSADFLEYEARAEAAAAAAAAAVAQSQQESGRAPRPKSSLDINRTPDSFYYSEASYADKMRKSALYLQSGG
AGAAQPQQPGSYRTTGADFNSGVNTIGYENPYERAYKRQELLAEAQGGGASSMPRMSRSASQGRSVASQLQSPQQEDLPP
LNVHPGSIFPPSMSTQEIISKNEQFLRSASARLPKRSGGMDDDYSAGNSTTTSPTGGAGASNSPQHNLDGERKREESMKR
LLEWKQRMLQSPLTRKGIQQGGSNMSAMSKLGSNPNILLASTAVASGARYAPQAGKTVLVGNGNGTAQGAGNPPSASGIQ
RSRSESQANVGPGGVVYNNYSSDDEASISVRNVNNLPVGNLTVKPDPSDVHQESAFAPYYGGAAETKYAKNTVLTDRGLY
AANGSGLATSTPQNHQQFRMRHTGSRAEIDMLERETSSQIRNLDVSAGDLLSRTHEELVLLLIQLRRQSSQTARAIEQCC
SDIHDVQNRLRSAEGLTRAESIQRLDYLKQHLLDLERHYEKSKPLVNLVDNMVKLGSLYRNDANGRVQPATLDRLEFNQR
MQEQQMLQEEQQQWERLSPNQAELQAKVRELYQLDQLLQEESGTLQSLQRDKEDLERALGGLRARIHDSNATPMALEAAK
KQQHILERELSRVHQLLAENSKKLEQTVAGNARLEQELLLLRQKVQAVRGSTTNGMNGDGSHINGDQTAAVLASELERVQ
SLVGDMQRQRHELSSAVRQLTENSTRLYQEIGNKEMNGGGSTNGSLKKRSNSTSWTETDLDANMLRCGSRQQLNDSTLNL
STPLYVDTNSSTKLSDYNRYNGSSDAIEMSGVDSDGFLDSNPFALGLEKQEIKTVRIVKRESERRNRDRSERGLSNSIQN
LDQVLEEEQYAQQQREQQLYAQNLEEPMTNGHHSRSKSLPRNYSEPPKQRHSRHLNGGKQNGHHYNGGYDYDRNSNYEHQ
PPPPPAPQSNGHHHNHQQREQREHLNPLANAYFAKQLQQQANPSRDSARVALRTKTDSLQSLNKSLTDISPEPVFQSVAA
RQIINEMSAGSASEDTEKVVEKVPPHHKHRRAVPREKRRHYTAPNNVNQKAMEKVQAENDMNRNNTNWRARDDLDMEVAL
RPRMNAPDVVRSALGQGEKISENTIDNLLLAPNKIVIPERYIPETTPELSPEEKKRRQEKVESIKKMLAEAPISSNENES
LPPSKINAEKKQREHLLQLNQILAQQVMQVSKIVAGNPTSHN
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0329897
6710
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0112622
7637
FBtr0112623
7109
FBtr0112624
8745
FBtr0290011
7037
FBtr0329898
9067
FBtr0329899
10319
FBtr0334567
10048
FBtr0334568
9215
FBtr0334569
6840
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0111534
1974
FBpp0111535
2020
FBpp0111536
2050
FBpp0288450
2020
FBpp0302932
1974
FBpp0302933
3090
FBpp0306634
1308
FBpp0306635
2020
FBpp0306636
2037
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG34383-PG
kmr-PG
Name Synonyms
Secondary FlyBase IDs
    References (0)