Open Close
General Information
Symbol
Dmel\fz2-PF
Species
D. melanogaster
Annotation Symbol
CG9739-PF
FlyBase ID
FBpp0303228
Associated gene
Length (aa)
806
Theoretical pI
8.13
Predicted MW (kDa)
85.4
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MRHNRLKVLILGLVLLLTSCRADGPLHSADHGMGGMGMGGHGLDASPAPGYGVPVIPKDPNLRCEEITIPMCRGIGYNMT
SFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPE
RMACEHLPLHGDPDNLCMEQPSYTEAGSGGSSGGSGGSGSGSGSGGKRKQGGSGSGGSGAGGSSGSTSTKPCRGRNSKNC
QNPQGEKASGKECSCSCRSPLIFLGKEQLLQQQSQMPMMHHPHHWYMNLTVQRIAGVPNCGIPCKGPFFSNDEKDFAGLW
IALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACDGLLLRESSTGPHSCTLVFL
LTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHL
KTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEAAYF
EDWIKALACPCAQVKGPGKKPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRFWRRLLGAPDRTGANQALIKQRPPI
PHPYAGSGMGMPVGSAAGSLLATPYTQAGGASVASTSHHHLHHHVLKQPAASHVXHGESGGASTMGGGGGGGSTLGGGTL
GHGTAMSSSTVGMGPLPGTLMHGASGGGVGGGNPGNVYGNGNNGVGGQNTAPGSVIDSRAVSVVVTLPGGPGAQHPGQAL
SDYGPI
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0330195
4448
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0075029
3673
FBtr0075028
3839
FBtr0112890
5113
FBtr0299586
4597
FBtr0330194
4345
FBtr0332735
5696
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0074796
694
FBpp0074795
694
FBpp0111803
694
FBpp0288861
694
FBpp0303227
694
FBpp0304981
694
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
fz2-PF
Name Synonyms
Secondary FlyBase IDs
    References (0)