Open Close
General Information
Symbol
Dmel\CG32982-PG
Species
D. melanogaster
Annotation Symbol
CG32982-PG
FlyBase ID
FBpp0303251
Associated gene
Length (aa)
720
Theoretical pI
10.31
Predicted MW (kDa)
79.0
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MLMHTTSISTTSTATMTNSSSSATPTPGSTSSNNSATLDALHQQQQQQHQQHQLQQQLQQLHTNAANNSRPPSRAPSILD
SPTLARVERARLRLEQQERERERERSSQREVGGGSGGGGGGGSSTGTGSTATTMNREDSLERSILDPKQSLLAGRIPVAS
MTGPIKRGLLWQQRDRLFSRWKERYFVLTRDYLHCFKRASGSANERASDMGQFIFKVKLVDVEKVEWLNRRSYSAIGLLL
GREGRVLLRCDDGLEDWFELLEECTMTSKERRRALKIAQGPRSRASLAAPVSHASLQFQHFGLGGTYSSALDDWLMTNGT
GGLARHKIGAGSLNGYGGANPFLFSDSVPDLSALNNENHNHHLSGISTNHSTPQKIPHHSNANLSRYSNGYVSAQNSFTQ
AGALYGSPRRIFINSSFGSNQVVDEETEETEVQLRRPRLFRGVSATPDNGNELDRDWLYRKPRAPTDMRHSVQPMLPTGG
GSNIGLAKTELDCSAHDSGLDTPPSTHRPSSYREASRDSTETNGSSSRGTLLNNSSPGGSFRAKKLSTQDQRILKMRNNE
EDRCASIKMANRLNQNQEQATYDPNQNRYYKNGNATPPTSLTPQHTPQHKLTMMHYGNGNGNMGTLNGNTNGSDRINGSA
IFRERYQHPALAAIINEAQGLKFRERAYSDSQQRRLNNNNGPTPQPASPLAQRRNNGGLGSGVGSGAIYGTPTRVXRLKV
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0330218
2766
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0079771
2761
FBtr0110960
2426
FBtr0301039
3241
FBtr0301040
3397
FBtr0303888
2931
FBtr0330219
2682
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0079372
715
FBpp0110260
550
FBpp0290261
778
FBpp0290262
793
FBpp0292891
730
FBpp0303252
687
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG32982-PG
Name Synonyms
Secondary FlyBase IDs
    References (0)