Open Close
General Information
Symbol
Dmel\isopeptidase-T-3-PC
Species
D. melanogaster
Annotation Symbol
CG11025-PC
FlyBase ID
FBpp0303280
Associated gene
Length (aa)
561
Theoretical pI
7.24
Predicted MW (kDa)
62.8
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MIPWMREKFNEKRAKWLARSKRSGGSPADESPRSSSHSHSQRTDASDAESLSGSSLNVHTAESETQTDGGISASNSRPLV
GGGSCVLRTPSPARRRRIHLELQLQRREERAEHQKVVPQDSPTPTHQQQANALFLRKSAHTNRPGSSTSGEADDASRPGE
SILVRVICPSSRVLIFKTDVNKRLNELKSEVILELSDDPDSIQLFAPDVRHLNPRYRLYRAEYFGGELNEGDTLAQLKVR
NNETFILSPRRNTLPQTVSRIREVPGPNEQLVESATRYVPVNCNQLPTIDINEIFQQSNIQYDVRKVLISLAQASAAVIG
AGPYAPRLIAMLKQRLINRRNQQADTLQCLVDMGFKRELAAFALKAHNGIYSTTMEWLIQNQNEENPQEPPGMNMQHSLS
SISPSTIVTNNETIENTAALIEIVRIYSHRDSPPSDEIVESLTEMGFEETAVLAALKKTGNNKASACEWLCDNRSGSVIE
LREGLAPDSPILKVILEMPQVQMTLSNPKTFLAFLGILENEHAIRVWRGDNDTTSVITHILQKYHEEKHVLGINQFYTNR
W
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0330247
2491
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0086473
2479
FBtr0086474
1778
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0085669
557
FBpp0085670
435
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
isopeptidase-T-3-PC
Name Synonyms
Secondary FlyBase IDs
    References (0)