Polypeptide Dmel\bru-3-PG

General Information
Symbol	Dmel\bru-3-PG	Species	D. melanogaster
Annotation Symbol	CG43744-PG	FlyBase ID	FBpp0303385
Associated gene	Dmel\bru-3

Length (aa)	390	Theoretical pI	7.31
Predicted MW (kDa)	41.7

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MVHIIELVGQPKVEFAQQVTMNRALQLKPAENESRSEHLDRKLFVGMLSK QQTEDDVRQIFHPFGTIEECTILRGPDGASKGCAFVKFGSQQEAQSAITN LHGSQTMPGASSSLVVKYADTEKERQIRRMQQMAGHMNLLNPFVFNQFSP YGAYAQLPSPPELQQQQQAALMAAAATAPGSAAAYMNPMAALATQIPHGL NGTGQPPSLPSPTMPNFNMGANTPNGQPGGAAAAAAAAAAADGVFTNGIP QTAFPGHPLHLTIPPQGLPNGDAATLQHAFPGLPPFPGVDFLMFPGCSIS GPEGCNLFIYHLPQEFGDAELMQMFLPFGNVISSKVFIDRATNQSKCFGF VSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDASRPY
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) bru-3-RG FBtr0330353 4953
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) bru-3-RA FBtr0330343 2587 bru-3-RB FBtr0330347 2410 bru-3-RC FBtr0330349 2509 bru-3-RD FBtr0330344 2467 bru-3-RE FBtr0330352 5007 bru-3-RF FBtr0330346 2332 bru-3-RH FBtr0330351 10570 bru-3-RI FBtr0330345 3865 bru-3-RJ FBtr0330354 2786 bru-3-RK FBtr0330348 2314 bru-3-RL FBtr0330350 2356 bru-3-RM FBtr0330355 6771 bru-3-RN FBtr0330356 2929 bru-3-RO FBtr0330357 2665
Other Polypeptides
	Name FlyBase ID Length (aa) bru-3-PA FBpp0303375 422 bru-3-PB FBpp0303379 363 bru-3-PC FBpp0303381 396 bru-3-PD FBpp0303376 382 bru-3-PE FBpp0303384 408 bru-3-PF FBpp0303378 337 bru-3-PH FBpp0303383 416 bru-3-PI FBpp0303377 384 bru-3-PJ FBpp0303386 49 bru-3-PK FBpp0303380 331 bru-3-PL FBpp0303382 345 bru-3-PM FBpp0303387 370 bru-3-PN FBpp0303388 403 bru-3-PO FBpp0303389 403
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_001189094 DDBJ / EMBL / GenBank • ADV37530
Synonyms
	bru-3-PG CG43744-PG
References ( 0 )
	No references are recorded in FlyBase at present.