Polypeptide Dmel\CG11455-PK

General Information
Symbol	Dmel\CG11455-PK	Species	D. melanogaster
Annotation Symbol	CG11455-PK	FlyBase ID	FBpp0303492
Associated gene	Dmel\CG11455

Length (aa)	101	Theoretical pI	7.85
Predicted MW (kDa)	12.0

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MSLTPFLRLPLTDLTGCLINHQTYDKCGKFEMKMMECFEAYGLERGKREC ADLISDFQECVGMQKQLMRFHAMRNERYKQWLKGERKGQEFFADPPRVDA Y
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) CG11455-RK FBtr0330642 798
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) CG11455-RA FBtr0078117 486 CG11455-RB FBtr0078118 623 CG11455-RC FBtr0301886 568 CG11455-RD FBtr0301887 507 CG11455-RF FBtr0306542 657 CG11455-RG FBtr0330638 678 CG11455-RH FBtr0330639 586 CG11455-RI FBtr0330640 415 CG11455-RJ FBtr0330641 869
Other Polypeptides
	Name FlyBase ID Length (aa) CG11455-PA FBpp0077776 101 CG11455-PB FBpp0077777 101 CG11455-PC FBpp0291100 101 CG11455-PD FBpp0291101 101 CG11455-PF FBpp0297500 101 CG11455-PG FBpp0303488 101 CG11455-PH FBpp0303489 70 CG11455-PI FBpp0303490 70 CG11455-PJ FBpp0303491 101
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_001259796 DDBJ / EMBL / GenBank • AGB92333
Synonyms
	CG11455-PK
References ( 1 )
FlyBase analysis	FlyBase Genome Annotators, 2004, Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. [FBrf0166453]