Open Close
General Information
Symbol
Dmel\SK-PP
Species
D. melanogaster
Annotation Symbol
CG10706-PP
FlyBase ID
FBpp0303993
Associated gene
Length (aa)
979
Theoretical pI
9.63
Predicted MW (kDa)
107.2
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MSIQKLNDTTNSGYVSSEETDSLLVSSSNPSKGGGRTALLRQVKSNSTNGPTTGASTSSSGSVSGGGGGSGSGGGSASGS
AAGASKPTLMRQDRTSTYLTSPQQSQHARMGSEESMRGGASGAAGHDEDVEQGLVRSSIVPDIEVHEEDQEQHSQQLNAT
TMATMTNNQQQQQPTISIMNLSLKPGDSHSHSSSPGSHPNLGTSSYQNLASSIPPSVPSRCRACRNCSRRASTTPTTLID
RSASRDSVKSAFQQGNLSGSMAICISNSALPQQQQLQQQYHLQQQQQQHYQLQQHHLHQQQLQQSQQQVPPVLITSSPTN
GSRIIRQSSQPESSSTAICCGPHSACVGHAHSHSHTVPNVSLKQLRESSGDGIAGIAADSLRINGGMRPFKQLRKPASTL
SIPGSMKTPSIANREQISSGCNEEAAEALVGIHSDYPRYMEERALTGGNTSRKPSTNSAKHKPNVGYRLGKRKALFEKRK
RISDYALVMGMFGIIVMVIENELSSAGVYTKASFYSTALKTLISVSTVILLGLIVAYHALEVQVRLFMIDNCADDWRIAM
TWQRISQIGLELFICAIHPIPGEYYFQWTTKLANKNKTIGTEMVPYDVALSLPMFLRLYLICRVMLLHSKLFTDASSRSI
GALNRINFNTRFVLKTLMTICPGTVLLVFMVSLWIIASWTLRQCERFHDEEHANLLNAMWLIAITFLSVGFGDIVPNTYC
GRGIAVSTGIMGAGCTALLVAVVSRKLELTRAEKHVHNFMMDTQLTKRLKNAAANVLRETWLIYKHTRLVKRVNPGRVRT
HQRKFLLAIYALRKVKMDQRKLMDNANTITDMAKTQNTVYEIISDMSSRQDAIEERLTNLEDKMQSIQEHMESLPDLLSR
CLTQHQERIEQRRNFLHPDTAAVAPIQAPTPQSMFNAAPMLFPHSSVPSSNNAAATYHWPTSPILPPISSRTPHLVPDTH
MPSNGSAVNSYASSNKYGS
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0331603
8050
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0300467
3729
FBtr0301949
3723
FBtr0301950
3556
FBtr0301951
4813
FBtr0301952
3885
FBtr0301953
8828
FBtr0301954
3484
FBtr0331602
4946
FBtr0331604
5179
FBtr0344555
3729
FBtr0344556
8050
FBtr0344557
3885
FBtr0344558
4813
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0289694
524
FBpp0291161
522
FBpp0291162
812
FBpp0291163
927
FBpp0291164
576
FBpp0291165
927
FBpp0291166
685
FBpp0303992
960
FBpp0303994
928
FBpp0310908
719
FBpp0310909
1174
FBpp0310910
771
FBpp0310911
1122
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
SK-PP
Name Synonyms
Secondary FlyBase IDs
    References (0)