Open Close
General Information
Symbol
Dmel\CG10803-PC
Species
D. melanogaster
Annotation Symbol
CG10803-PC
FlyBase ID
FBpp0304001
Associated gene
Length (aa)
574
Theoretical pI
10.00
Predicted MW (kDa)
66.2
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MEKEAISNQPLKDEPSKDEPNQSEGTAISTIPAIDKLRRFCFIGSTDEPVYTTPALDLVVENNFASLKELCSQVSEDELV
ECLLSVLGSEPNEEQPPRPDEPLLILAVFFTTCEDEKKRNAVRNRFTDLITSESDLLLFVQLVKRVQKLLERKTPFNRTV
RKAVLNWYGTKSLDRLLHFWSIGDGNRWPAHRDLLYRLHFRHANFLPEIIAALRLLSSSPKELSQWPDFLTPLTSFRETI
EGVVKLRLLTDPEQAISIVKKLSLSWEHVPFHLLHDPRLAHFLIPHMSYEQLLQKWPRLSRLNSRVRPFAEQLLDKKKLK
ASNVPPVRLLLEDMRLRKPKKVVNQLVLPSSLKNKNTFKFQCATTSFQKASFLHSVYEISFGLNKALGRRLHITLNLEQA
YLGKYLSGPCRSLKYLDALVALGFGYFRSDRKVTVEFWHDRSGKLKALPWTNEMSVSEAKTCCENQKVGKVRQSLNEILF
RALLDMQNTFDVFLVLVPGAARGNPENNSKCLAALMDKYREKRNSNAKFIMVSLRQRQRSMIYSSGRNENLLELCSLDKH
TPRLINAFVRNKFY
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0331611
2890
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0070569
2794
FBtr0331610
2896
FBtr0331612
4798
FBtr0332285
4744
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0070544
637
FBpp0304000
574
FBpp0304002
574
FBpp0304564
617
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG10803-PC
Name Synonyms
Secondary FlyBase IDs
    References (0)