Polypeptide Dmel\CG11284-PD

General Information
Symbol	Dmel\CG11284-PD	Species	D. melanogaster
Annotation Symbol	CG11284-PD	FlyBase ID	FBpp0304120
Associated gene	Dmel\CG11284

Length (aa)	250	Theoretical pI	6.90
Predicted MW (kDa)	28.8

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MPVQSPIEISNRAIEHIDDVDPLEYHGHWEPVGVARVQNTGTSAMVTFSK RKQQPYIIGGALEQDMYVFEQLHFHWSDCDESGCEHTLEGMKYSMEAHAV HYNSKYKDFTEAKNKPDGLAVVAFFIQACGEKDCPEFKKITEGIRIVQKI HTSASLDSDCLSWIGLQELSKHYYTYKGSLTTAPYFESVTWIIYRTPIYV SRGQVQVFRNLQSCPKDESKKIVNNYREIQRPHKDPEIFFARNTNPKSKL
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) CG11284-RD FBtr0331731 1650
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) CG11284-RA FBtr0071222 2010 CG11284-RB FBtr0331729 1801 CG11284-RC FBtr0331730 1897
Other Polypeptides
	Name FlyBase ID Length (aa) CG11284-PA FBpp0071167 250 CG11284-PB FBpp0304118 250 CG11284-PC FBpp0304119 250
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_001259351 DDBJ / EMBL / GenBank • AGB95194
Synonyms
	CG11284-PD
References ( 1 )
FlyBase analysis	FlyBase Genome Annotators, 2004, Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. [FBrf0166453]