Open Close
General Information
Symbol
Dmel\CG5618-PE
Species
D. melanogaster
Annotation Symbol
CG5618-PE
FlyBase ID
FBpp0304204
Associated gene
Length (aa)
346
Theoretical pI
8.69
Predicted MW (kDa)
39.1
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MYGMVLARYKIAPEVKTSGMFGMRPLVLFTSDESHYSFVKAANWLGLGSYNCVSVRTNERGQMLLDDLEAKIAEAKARGG
EPFFVNCTAGTTVLGAFDDINGAADVTERHGLWLHVDACLGGAALLSAKNRSLIAGLERANSFSWNPHKTIGAPLQCSLF
LTRESGRLLERCNSTEAHYLFQQDKFYDVSYDTGNKSVQCGRKIDAFKFWLMLKARGYGKYGLMVDHAIHIARLLEGKLR
QRGDRFRLVIPEHEYSNVCFWFIPKAMRVSSEEETPEWWSRLYTVAPKIKEQMAHSGTLMIGYSPLKAKNLGNFFRMVFT
CFPILKSKELDFILDEIERLGEKIVL
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0331820
1750
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0078179
1938
FBtr0331819
2230
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0077837
510
FBpp0304203
346
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG5618-PE
Name Synonyms
Secondary FlyBase IDs
    References (0)