Open Close
General Information
Symbol
Dmel\Wbp2-PE
Species
D. melanogaster
Annotation Symbol
CG11009-PE
FlyBase ID
FBpp0304356
Associated gene
Length (aa)
384
Theoretical pI
6.79
Predicted MW (kDa)
40.2
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MSVNTAHANNGVLIHAGEYILLHSDSVSMEFSGQDNPIFKGSKGGRIYLTSHRMIFNSKKSSDSMQSFSAPFVALSDVEI
EQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAIEYGQALLRSAKTAMNNYHRGGLAGDDPPPYQPAGSWNEAPPP
AYQPPPGYYGWLPQHDAFSGPAPNTVYMSDNPPPYPGIAPPAHQPAPQQPQAPSSNEPNWYGFSAPPPQQQQQQPGYGPQ
GWAGGYVQPPPYASCAPNCPPQPPYAAPAQTYNGPQPYGGYGNVPGGFNTPGFQQPNGNPNGYPGGPPPPGQQAAGAAGG
AAASGASFMGFSLPPGNSKEAEAAASAYNTPYNQGGPSGSGNNDLPPSYNNLPPSYDDASKKNH
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0332046
1610
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0273240
1758
FBtr0273241
1751
FBtr0332045
1291
FBtr0332047
1242
FBtr0332048
1369
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0271748
337
FBpp0271749
337
FBpp0304355
226
FBpp0304357
199
FBpp0304358
342
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
Wbp2-PE
Name Synonyms
Secondary FlyBase IDs
    References (0)