Open Close
General Information
Symbol
Dmel\CG7546-PH
Species
D. melanogaster
Annotation Symbol
CG7546-PH
FlyBase ID
FBpp0304453
Associated gene
Length (aa)
1332
Theoretical pI
5.77
Predicted MW (kDa)
142.1
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MLINLKVKTLDARIHEFSIDNELTIRQFKDQIAEKTNIAAENQRIIYQGRVLVDDKQVKEYDVDGKVLHVAERPPFSQRG
ANARNNDEPMRTFRNVARPPPPGMRTSPYFRALDGMLVGTMAIPVNNGPVAGQTRPPPNRYPNSSSFCINRITVALHMID
CADNIAAYLENPAVGLNNQSLDILQRGRWSMESTVVEVGVSSTDLPRNNNIIDMVQDAVTAALSHTGARNYTVVQLPTVY
TNENGETSQQRTAEAITSEGAASGAASNASGETTAATVIIEDVIETDDEVADGASDRSVTPTPEPEAEGAVGGQQVTAAE
TPTSSVGSANDAAAEGGNNSGPRRRTRPQVLAQVIQHYRGVQARLAPFVDRYYEILQNDPTFEESDTDGRENAQRIFDRV
SEAFHYLSHAQHAISDLMLDLSQPGPRVLTCRPILVEQSGYIRSNNIFTPNFLAPPSGIINEPFRNRAPGSASAAGTQTA
TTAGTQTPTSAGTPTAVAPSQAANLQAATDASRSAAAMAEIASRAAGAAAEMAAGAASAAAGAANAAAAAARDLSSDQVE
DPIDEPMVGPNAAGAETLAQEQQRLEMDHDHDQAQSETPERETRPVPRLRVYVPVTLPPPNPQLEMARIIQAMVNGQRPN
DIHVEFNAPNVMSINLPVHVMTTVRQAPAAGSNETADQSASESSSPESAPASGNGESPNAASTSSGTRSGDQRANTLPTT
ATQTRSTSRPQIQIGGNNNWGGRIAPTHTAFDRFLPCNSHHIREPEQLLQNNSTSRSTSTAPAGGATVVPPTSAAVTRPV
TTGRIQRGSNTIRPMWSSRRQRPASEQLSNLGPAAWAQAQTQTTHIPSAHVGAGSTNGAGVGAGRVRPVGGSTINRDRLA
TRTAHVGGGSTNGGLPSGRRGRLQAATSRLSRHLPTQLANFLINNMRNNAPTASVGSAVAAVGDTAASPSGEAAPIASTT
PAAPLQTVLPTSTPTPRGDSNNLRSQLRTFLNDSLFVGVPINEQTIPGAIGRALDWFGESLVYLPQYERPEYNSRDSVCN
ILRVSLRLIIELCNGAPAGVDSAQFEQSLKQICDQFRKRLYSVLFLCLGSANAELYWRQLMRLLCAPMRSNFRNEALQFL
CIYIDPTIPAQTDTVDAQQFLVLRSIQAAPPTAADEQLQEQTLDTDVEMSEVTASGSNSSPADELPAVIVGSEPWHMSFP
NDWLPVITRDLQTQAEQSNRPQPPFSDAYISGMSAKRRKIIQSEKPTASVECLIANGVQRAIQSVGLGGSNGGSALNASI
SMDTVIGSIAHDSTIQAAYTDAVRNSLKERTERDVDFKTSKYPQIAKFTEQK
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0332143
5240
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0076791
5240
FBtr0076792
4742
FBtr0290025
4841
FBtr0290026
5282
FBtr0305073
5138
FBtr0332141
4745
FBtr0332142
4781
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0076505
1332
FBpp0076506
1166
FBpp0288464
1199
FBpp0288465
1346
FBpp0293610
1298
FBpp0304451
1167
FBpp0304452
1179
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG7546-PH
Name Synonyms
Secondary FlyBase IDs
    References (0)