Open Close
General Information
Symbol
Dmel\CLIP-190-PP
Species
D. melanogaster
Annotation Symbol
CG5020-PP
FlyBase ID
FBpp0304724
Associated gene
Length (aa)
1623
Theoretical pI
4.62
Predicted MW (kDa)
182.9
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MKVNIKKCTHIQMGKQKPKKNEATSMSRESDDNLSSINSAYTDNSSAVLTANTEQFIIGQRVWLGGTRPGQIAFIGDTHF
AAGEWAGVVLDEPNGKNDGCVSGKRYFQCEPKRGIFSRLTRLTTYPLAGAQTPTSPLAKSSPDRSRTVSPTASIRSSMLR
SPGIGGKNGMAVGDRVIVSSGFGSRPGILRYLGETQFAPGNWCGVELDEPSGKNDGTVDDIRYFECKPKYGVFVPIAKVS
LSPSSKKTRLSRTGSRESLTSIGTMNSIATTATSRMRMNAQQRKSSTPVKPILATPKSQFSMQDLLREKQQHVEKLMVER
DLDREDAQNQALQLQKNINELKARIVELESALDNERKKTEELQCSIDEAQFCGDELNAQSQVYKEKIHDLESKITKLVSA
TPSLQSILPPDLPSDDGALQEEIAKLQEKMTIQQKEVESRIAEQLEEEQRLRENVKYLNEQIATLQSELVSKDEALEKFS
LSECGIENLRRELELLKEENEKQAQEAQAEFTRKLAEKSVEVLRLSSELQNLKATSDSLESERVNKTDECEILQTEVRMR
DEQIRELNQQLDEVTTQLNVQKADSSALDDMLRLQKEGTEEKSTLLEKTEKELVQSKEQAAKTLNDKEQLEKQISDLKQL
AEQEKLVREMTENAINQIQLEKESIEQQLALKQNELEDFQKKQSESEVHLQEIKAQNTQKDFELVESGESLKKLQQQLEQ
KTLGHEKLQAALEELKKEKETIIKEKEQELQQLQSKSAESESALKVVQVQLEQLQQQAAASGEEGSKTVAKLHDEISQLK
SQAEETQSELKSTQSNLEAKSKQLEAANGSLEEEAKKSGHLLEQITKLKSEVGETQAALSSCHTDVESKTKQLEAANAAL
EKVNKEYAESRAEASDLQDKVKEITDTLHAELQAERSSSSALHTKLSKFSDEIATGHKELTSKADAWSQEMLQKEKELQE
LRQQLQDSQDSQTKLKAEGERKEKSFEESIKNLQEEVTKAKTENLELSTGTQTTIKDLQERLEITNAELQHKEKMASEDA
QKIADLKTLVEAIQVANANISATNAELSTVLEVLQAEKSETNHIFELFEMEADMNSERLIEKVTGIKEELKETHLQLDER
QKKFEELEEKLKQAQQSEQKLQQESQTSKEKLTEIQQSLQELQDSVKQKEELVQNLEEKVRESSSIIEAQNTKLNESNVQ
LENKTSCLKETQDQLLESQKKEKQLQEEAAKLSGELQQVQEANGDIKDSLVKVEELVKVLEEKLQAATSQLDAQQATNKE
LQELLVKSQENEGNLQGESLAVTEKLQQLEQANGELKEALCQKENGLKELQGKLDESNTVLESQKKSHNEIQDKLEQAQQ
KERTLQEETSKLAEQLSQLKQANEELQKSLQQKQLLLEKGNEFDTQLAEYQKVIDEMDDAASVKSALLEQLQNRVAELET
ALRQANDAQKTAYLETKELRRQLESLELEKSREVLSLKAQMNGASSRSGKGDEVESLDIETSLAKINFLNSIIADMQQKN
DALKAKVQTLETLPMDFTKPHAFDALTKRKPAPRLFCDICDEFDQHDTEDCPIQGSEDQDYSTPSSESNNNEKERKLPAP
RKYCDSCEVFGHDTSECADDETY
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0332451
5349
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0080976
5917
FBtr0080975
5625
FBtr0080977
5453
FBtr0290262
1723
FBtr0290263
1615
FBtr0301440
5851
FBtr0301441
5291
FBtr0301442
2664
FBtr0332452
1900
FBtr0332453
5283
FBtr0332454
5806
FBtr0332455
1549
FBtr0339796
1357
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0080529
1690
FBpp0080528
1689
FBpp0080530
1652
FBpp0288701
365
FBpp0288702
328
FBpp0290655
1668
FBpp0290656
1598
FBpp0290657
456
FBpp0304725
311
FBpp0304726
1601
FBpp0304727
1653
FBpp0304728
306
FBpp0308841
327
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CLIP-190-PP
Name Synonyms
Secondary FlyBase IDs
    References (0)