Polypeptide Dmel\akirin-PF

General Information
Symbol	Dmel\akirin-PF	Species	D. melanogaster
Annotation Symbol	CG8580-PF	FlyBase ID	FBpp0304976
Associated gene	Dmel\akirin

Length (aa)	201	Theoretical pI	9.46
Predicted MW (kDa)	22.7

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MACATLKRALDWESMNQRPPKRRRCNPFGQAGSNAGPASPSRDGPSTSAG LPHTPSNRFAKDSTEPSPFSESSLAKMSPDKMAESLCNEIKRLHKRKQLP ITSSALERMQDSESSGSEMGPESPRRPDSPQNLMRHGEKALFTFKQVQLI CESMIKERENQLRERYESVLTTKLAEQYDAFVKFTYDQIQRRYEAAPSYL S
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) akirin-RF FBtr0332730 2080
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) akirin-RA FBtr0076848 1268 akirin-RB FBtr0076849 2080 akirin-RC FBtr0302543 2065 akirin-RD FBtr0302544 2196 akirin-RE FBtr0302545 1127
Other Polypeptides
	Name FlyBase ID Length (aa) akirin-PA FBpp0076559 201 akirin-PB FBpp0076560 201 akirin-PC FBpp0291699 201 akirin-PD FBpp0291700 201 akirin-PE FBpp0291701 201
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_001261511 DDBJ / EMBL / GenBank • AGB94206
Synonyms
	akirin-PF
References ( 1 )
FlyBase analysis	FlyBase Genome Annotators, 2004, Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. [FBrf0166453]