Polypeptide Dmel\CG43897-PH

General Information
Symbol	Dmel\CG43897-PH	Species	D. melanogaster
Annotation Symbol	CG43897-PH	FlyBase ID	FBpp0305048
Associated gene	Dmel\CG43897

Length (aa)	355	Theoretical pI	9.12
Predicted MW (kDa)	39.9

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MAALQRKLVHKQFNSPMGLYSQENVKATLNRELKAFGGEGIEVDDQITKP LNLANSAVLRAVEEEEQQAKCGYKRVAWPPASEERIIREFTPQPQTQSPA PGAGGYYPQAHAPTAAAAAPPQQQQYGAPSYDGQQPGAQWQQQQQQQQVP QQQYQPQSQAQAPYQPPQWNQPQQQQQQPSYQASPYQQQQQQQPSYYPQQ NGGSTYAQPPYNSYSQPQLPYSQDQTDLQQQQQQQQQQYPGAYAGQDSYR GASPGIITLRKEAPVSQKPAPVYTSQPAAVSYQGGSKLRGDLKWPPPEYK EAAARENEERRQLALGPVCRPRRVNRDYTPFFAKHQLNNGYPSYKVPPGT QHIFG
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) CG43897-RH FBtr0332825 2802
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) CG43897-RA FBtr0332823 2956 CG43897-RB FBtr0332819 3240 CG43897-RC FBtr0332821 3497 CG43897-RE FBtr0332820 2515 CG43897-RF FBtr0332822 2799 CG43897-RG FBtr0332824 3056 CG43897-RI FBtr0332826 2548 CG43897-RJ FBtr0332827 3076 CG43897-RK FBtr0332828 3074 CG43897-RL FBtr0332829 3107 CG43897-RM FBtr0332830 5929 CG43897-RN FBtr0332831 5587 CG43897-RO FBtr0332832 3546 CG43897-RP FBtr0332833 2913 CG43897-RQ FBtr0332834 2827 CG43897-RR FBtr0332835 3268
Other Polypeptides
	Name FlyBase ID Length (aa) CG43897-PA FBpp0305046 462 CG43897-PB FBpp0305042 501 CG43897-PC FBpp0305044 501 CG43897-PE FBpp0305043 315 CG43897-PF FBpp0305045 354 CG43897-PG FBpp0305047 354 CG43897-PI FBpp0305049 206 CG43897-PJ FBpp0305050 501 CG43897-PK FBpp0305051 502 CG43897-PL FBpp0305052 500 CG43897-PM FBpp0305053 1385 CG43897-PN FBpp0305054 1339 CG43897-PO FBpp0305055 215 CG43897-PP FBpp0305056 123 CG43897-PQ FBpp0305057 299 CG43897-PR FBpp0305058 446
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_001033997 DDBJ / EMBL / GenBank • ABC66157
Synonyms
	CG43897-PH
References ( 0 )
	No references are recorded in FlyBase at present.