Open Close
General Information
Symbol
Dmel\ImpE1-PC
Species
D. melanogaster
Annotation Symbol
CG32356-PC
FlyBase ID
FBpp0305271
Associated gene
Length (aa)
1616
Theoretical pI
3.74
Predicted MW (kDa)
177.0
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MTATARQSATSRKQPAIAMLNGNAFTVKRLLALLIIFTVVDASRSLELGDKCQHDMDCTDFIKGSSCSALGYCECAPYFV
QLDSKRCLSSQLLGGDCQLSEQCSMKVANSSCLEGACRCVEGFLQFRKHTCLGPAHPGAVCYSHAHCQMFDTRTHCDFLI
PNLFGRCQCTSPAKMVGGLCVAPAADQEDQKQEQAVEKVEQPASSTTTTTTTTTTPRPTTRTTSRTTTTTTAAPPTTTRR
TTTTTTTTTPAPILLEDELPASVEEQSLEEDDGETTKLRPEVVEVDNGEKLEAVDLAHEETELTQQQNQLDEQQHQEEEQ
KHQEEEQHRIEQQQNQEEEQQQQQHQQQVIDQASDAELPQSSQDATTGVQQLLTPADVPTEDAINAEQETEAGPTEDYPY
KIDEEYTEEHNDKPEAPELTVDQPEHEESPVATEIVPIEADEEAAEASGGQEIASSPIDDTMKFDYETSVDDVEPAKPED
EKETEAVHQATNEGVVPIDTESETDAETSTEPQIQTQLLQEDGEPETSQTVADEELIPVNEGETESVTKAADETEEIPEE
ETPEDLASGDHELDVAAASHDDEVETPKQEEPTEALKIEQPAQVESESQNVDEVGKPEEPQAEMEIEKEKEETAATEAAE
VELPATEAKPDMESEIDQVEQSADIKPTSGEDDLNEANQLNQDQVTEPAALEQEEIEEKEPEQVVDMHEDADEATTEKPV
QDHDQEEVEAITEAEHGQLTYPTNDDELAPVEIEPELTTEEPEIAENTTELPEQQQQQQDEEEIEEAALAHEEQVQQVEP
EENANAIKTPEVSEAIAEPQADLETPSATEKEIEPQTADHVEEEPVAITERIQEAEPEPEIEPTNDEVSQVDADQAEPEL
PIKSDADIAEEAAEEPAQTEVAPEVETETEASESAQTSPEISVEQDEVAIDKNENDNIIQGAEPNEEDELIPEPQPMPEE
EELPVQQEASAVPEDHKLTKPEMDYTSVEHLQELSRPEETTAAIEAEESDSRESTLAPEAPDAPIAIVSEERDPEHDPQN
FHESESIADILSDLMLEADSTVPPVPFGQQPAQTVPMVEANSENEEEQAHEAISDLQAEADETQEHAEQVQPVNEPGTAI
PELFAEAAKDEEDVPALPESDESKTEQPSALEVEQHIASEAEQTPVEDEHQYDEEEHQQDQEEHQQDEDEPLKEVETESL
PEEATTEKFQEPEPEEVNTPLPEELPFDLTDHSDVNRFNELQSESLILESTTNIDGLQELDNNHIEEEEPAAHAIPHEEA
TPNPADIVEITTQTMLGLASRVTLMEPAAPVVTTLMPLMTADEPTPEPVSPAAIPSASLAAIKPGTELRKRVDLGLEAVS
LGLACSSDRQCQLADPHTVCNRRGVCDCAAGEEGSQCSAERTGCSPGTFQCRSSGVCISWFFVCDGRADCNDASDEECTH
NARLNQTCPTESFRCQRSGRCISRAALCDGRRQCPHGEDELGCDGSVKGGNACPEHTFRCGSGECLPEYEYCNAIVSCKD
GSDEPPHLCGSRALPNLFMRLIEAGGLLGGGRREADAYCPHRCSNGLCRSTAIVCSGRDGCGDGTDEQTCSVCRCPAPTA
ASLPAFLARQRPMPLW
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0333057
6099
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0076606
6043
FBtr0076607
919
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0076333
1616
FBpp0076334
146
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
ImpE1-PC
Name Synonyms
Secondary FlyBase IDs
    References (0)