Open Close
General Information
Symbol
Dmel\CG43078-PK
Species
D. melanogaster
Annotation Symbol
CG43078-PK
FlyBase ID
FBpp0305322
Associated gene
Length (aa)
2464
Theoretical pI
4.57
Predicted MW (kDa)
277.3
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MESKRSKKGRKSRPSESEHPSNQQQEQQPHHHHPWDEGRAIQDPSAKSPQANRAIPSTGTALTRFLTCMAPVIVSLPGAG
TGPTEQPTILLINGIASDSQLEDKQSKAAALKLALDNNNSEATAPAPAQPHQVPTTPGGSHLLDFESHLIESIADEASGV
GIRELTPFEQELQRGTSKAGTNDTDPVIEVEPAGVRTKQPVEISPPAHQIAEVDETATPSEEVRRTAEQLVDEIEQELIQ
ALSRDVDEAQRVHEDQVQRDRDEISALTQQVEVQLNELTGILKNKPQAEIVLELPAEEEEEQKPKPFVAAPSELKLVEVP
TPKTEAEEQERKEFIDSLPQIEQNRLQGVSGSEETDAQKLSADCKREYYQSLKKYLLHSSQEKPPVPLQTYRWEDLKRAK
ERGGYPWTHLYKRPLGPDEQPEIVLLLRKSQELRFKSESPKSLKKVRYDEQVLVKETERYIQDLSEDEAVATTTDDSSEE
SSDSETESERDQHNEDALSECISCVSDSVLAVGGHARPRKTNRLAHIRDLIRRRRSGRTHEDAQSLPGNSANPSRQSSVH
ELAPPPGSLIPNADKPPKSSKPKQGFDIMKKLKSLAERQKKRLNIKRITLKKDEKIVLGEQQKIMKLKASPKSDRGEIPH
FIEKQDSDEILELVEYDESPCRKRTKEELLEDQPSGSGRVPEPDEIIELPVVKTEIEAPTVEVTEPAEEKVDHKEEKESE
AEEDPPKKTPRIRREHVYEEIGQAGSQELVNQPILELESLKKSLTRQDNLAIDEIEAAKAVPLDRMGSSEEEQVTAGKPG
ALFAPISSIDSTSSDEDRARLAQLSPVTEESDEPMDISPDLRPSIKKEASPAPSDKKVTFSHVEDEAEPHREDVELPEDV
LEAATNAAKWKNESDHEYEPVGVTPAHESSPAPSPQSELQLPMDIDLPLSSAGTTPRTESRTDYEIHTSQVDSSALEELP
LQPENRRKGFMASAQDRTKKMQDGIRLQAGKLRTRLQTKPKPKPVSGSPKGKAKERRRFKAPEFSKIKMPEIRRPDMSKL
KELKRPEFTKFNKPDMSKFKLPEKFSTLKLRRSKSFKENEGEVVSDETPEGTGGTASPTQPAPKKKFEFNFGTYPRAFRK
KKPVEEPVAVATESSLGTEGLSVIPSTETQPSQTSTSSPQGDRGPGPVRSRWADKFSDVSYNDSEGSRYRRYGSELESFD
RESSLERRMKEDLEGTEDTASEAQPQQEMGILGVVADNKQFAEFDEENRAIHEISSKRSREFKRRPMVHQDSDLRSEDSR
DAEGWTEKDIQKNKLLRKAELEAEAGFYKFHDLQDAQSTASSGKKVVMETIDDDEFFLRKRGISEDNIQLRQYISEAIRE
GYDMPNALKHVGYSAEQVPAEYGDYDVPPAKPRRLHRNYQPDFDSQEFQRSDYGDDLSMSQNGSEFTPKRPLRKARSRSK
YSIEGSQDIPQDGGSSIQYFEDDEEYLRPPARDQPLTDSEQALNNLDLGGKAAAMIQEEMEQELQNKPRPQAPRRQKKRT
RDDASVDKDADSFINGFGGRSVSNTFLQPHEDVIVYRTEHEYRHIPLATPDRFTDATSARTQRSEDDRTSRGADSLILDG
HIKSRAELDDNEDVGPRTRSDEKFVIDMLESDGYESQKEKTKQPEEEDDYEEPGALDRSNLQSGAVINKMKFRPLPPPPR
PPREKRSTRAGSQTHESYEDSEQVASSSQADSYDQGEFEVEVSTQTDPLPDDFVCEEFEITEDMKIIEPRRSNGSANKTL
EDLLRSVEAAQEQDEVDGARVLSEDEQLAKGLQRFRDANQRSMSERSRASSQADRSKSLSRPQTPSSAVIIERRVPTPSL
TVGEDDATVQASLIVRPISAADLIDDDLRREEEELRREGLLSDSSVQSKSDVEDEHGEVALSDYAASTADLDAAVEQLQQ
AQLESDYESKLEDDEVERTLRDSEYEEEKFSEQEEEQETTKLEKELTEQELEEALEKELQEAMEKELSDYRQKEKEQESE
QEQAFSEEELAASEIDYHQSEEEQATSEVGYHPSEDEHPLSDGEQPLSEEEHTLSDTEHTPTEPETQKVEETIHKSTASE
PTEAEVELKFVATLPTEPAFGDKEEEPEEPPLPPPRRKSTTALETIATTALTIAEQYSRELTPIQTVQSAPEPQFPSRLA
ELEVERLRVHALQAGQIQVSQLHGNQVKADDLQCKSGQLVVQNIELPPGFIDDIVERVQREQRPSLLTTETQTSRQASSE
PATSEKELPVKPPRHSKTTEQVPPASNLDEQTQTDAGLLPLPPPPTAYPSVEYLQSLAPLAFFNLQRSAEAEEAEDLKSV
ERKAPHKCRRRHVQEPLEPESGSEPEEHLVERPRSRSRRSRTRSATQPLDEDYDDDQPKTVAQAGRNFASACSLELVNII
NQLTHYVRGEAMEPQQATRNISALVILFIAITLAVLVFLLTGRQVHTHHWDYFNPPGNDHGRQT
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0333111
8538
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0304807
5320
FBtr0304809
5763
FBtr0304808
5318
FBtr0304810
6099
FBtr0304811
5675
FBtr0304812
8498
FBtr0304813
8664
FBtr0304814
8316
FBtr0304815
8673
FBtr0333112
8513
FBtr0333113
8255
FBtr0340707
10607
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0293347
1653
FBpp0293349
1709
FBpp0293348
1126
FBpp0293350
984
FBpp0293351
1678
FBpp0293352
2455
FBpp0293353
2540
FBpp0293354
1957
FBpp0293355
2509
FBpp0305323
2514
FBpp0305324
2428
FBpp0309526
2509
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG43078-PK
Name Synonyms
Secondary FlyBase IDs
    References (0)