Open Close
General Information
Symbol
Dmel\Jabba-PI
Species
D. melanogaster
Annotation Symbol
CG42351-PI
FlyBase ID
FBpp0305366
Associated gene
Length (aa)
406
Theoretical pI
6.09
Predicted MW (kDa)
45.9
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MAQETKTVATAKDQNQRDHIDEEEVIELHESRSFYDRVREQAERFASTRVGQFVIERADKALAMIEDTAKWSLPQDKSSA
PLERPLPWAPFLMLIVLLRLTRIWLSVGALMIGNGPISPTDMVYFIQTRRRKLRAIRVHGLKVMRRRQQEVSYGSGKGMT
QKLNQWFSRAMCRPGVQQDSSSRRVFVRHSEQGLSNFVVKRPREEDCNADADLTIDQMLAKYANENSEDDSDFVPNEEEE
EEESSSSSGESESESGSSEGISSGEVDEVVSQPKQKSAGAVVENGVHKAEEKENDKGKLNITTTSNGNNDKEQADVGSPT
CFNTSLGTQALLKRASIQSVLAHSTPTTEMRDQPIEEANNSVPQTPETEKTQPQTPKEVHNQNQQQNQQQRQRNHPHQRY
RGRNRR
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0333163
1567
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0299942
1323
FBtr0299943
2029
FBtr0299944
1622
FBtr0299945
1628
FBtr0304051
1925
FBtr0304052
1663
FBtr0330006
1667
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0289219
320
FBpp0289220
560
FBpp0289221
367
FBpp0289222
438
FBpp0293014
537
FBpp0293015
438
FBpp0303041
388
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG42351-PI
Jabba-PI
Name Synonyms
Secondary FlyBase IDs
    References (0)