Polypeptide Dmel\CtBP-PI

General Information
Symbol	Dmel\CtBP-PI	Species	D. melanogaster
Annotation Symbol	CG7583-PI	FlyBase ID	FBpp0306583
Associated gene	Dmel\CtBP

Length (aa)	379	Theoretical pI	6.77
Predicted MW (kDa)	41.3

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MDKNLMMPKRSRIDVKGNFANGPLQARPLVALLDGRDCSIEMPILKDVAT VAFCDAQSTSEIHEKVLNEAVGALMWHTIILTKEDLEKFKALRIIVRIGS GTDNIDVKAAGELGIAVCNVPGYGVEEVADTTMCLILNLYRRTYWLANMV REGKKFTGPEQVREAAHGCARIRGDTLGLVGLGRIGSAVALRAKAFGFNV IFYDPYLPDGIDKSLGLTRVYTLQDLLFQSDCVSLHCTLNEHNHHLINEF TIKQMRPGAFLVNTARGGLVDDETLALALKQGRIRAAALDVHENEPYNGA LKDAPNLICTPHAAFFSDASATELREMAATEIRRAIVGNIPDVLRNCVNK EYFMRTPPAAAAGGVAAAVYPEAPECARP
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) CtBP-RI FBtr0334516 2382
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) CtBP-RA FBtr0082699 3959 CtBP-RB FBtr0082701 1719 CtBP-RC FBtr0082700 4383 CtBP-RD FBtr0082702 3946 CtBP-RE FBtr0100161 2612 CtBP-RF FBtr0334513 3950 CtBP-RG FBtr0334514 2590 CtBP-RH FBtr0334515 2627 CtBP-RJ FBtr0334517 2612
Other Polypeptides
	Name FlyBase ID Length (aa) CtBP-PA FBpp0082167 386 CtBP-PB FBpp0082169 386 CtBP-PC FBpp0082168 386 CtBP-PD FBpp0082170 386 CtBP-PE FBpp0099514 476 CtBP-PF FBpp0306580 383 CtBP-PG FBpp0306581 473 CtBP-PH FBpp0306582 481 CtBP-PJ FBpp0306584 476
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_001262523 DDBJ / EMBL / GenBank • AGB95905
Synonyms
	CtBP-PI
References ( 2 )
FlyBase analysis	FlyBase Genome Annotators, 2005, Changes affecting gene model number or type in release 4.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 4.2 of the annotated D.melanogaster genome. [FBrf0182792] FlyBase Genome Annotators, 2004, Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. [FBrf0166453]