Open Close
General Information
Symbol
Dmel\Xrp1-PG
Species
D. melanogaster
Annotation Symbol
CG17836-PG
FlyBase ID
FBpp0306591
Associated gene
Length (aa)
668
Theoretical pI
4.62
Predicted MW (kDa)
72.8
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MIQEPARVQAAPTFEATIREDNAKYQETAAGGTYSSPNCSCSQRRTRPTEPTKDSPTSTITTIPIVIDSKPNPRILLIRV
PTSNRGSNSNNNSNSTRSGTEHRAPRTRIIRIPFLPGSVPTRPPSNQAAPATSSLVNPIGSARRCRISTYPTTGTLTSRS
QPETVAGLPTTAMVNQTVPVLSSAPQTQTLAAMAGIQLTGADEPPSRRDVSGAMPTATVEEIDVPVFIDEYLQDIEATSS
TCNSENGKEIFTETDILDFDINMFAEEDLIELEGKKTDPFSPAMDGMNNDNLDDDFLQLNDLLNEEETFDMSSMSGVGID
INQEQELDFINIFHNSQPTAMLTSSEDPYLATYSQATSTSSTTKFITEEPLLADMTSFDISYTSSQELGFGLVEDVSGSF
ASSCSDVAAAIPAPIQHPIITNIKRSAPAPVESQPTKRSRLMLQIKTELAPAFSPTTPEIINQLLNDDRFEAPTTSTSTS
TSNTSISSSTHADIVEDLRSAEEETTTDFSAPNTPHSNYSASSSCAAPTCQTGYGGFLTAPTSPAYSTASTSVFSPSPAS
GISGKRKRGRPAKDHADGPDPVLMSSMKSEEERKAYQDRLKNNEASRVSRRKTKVREEEEKRAEDTLLAENLRLRARADE
VASRERKFKKYLMERQRQKSTYVKQEQD
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0334524
3167
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0083701
3027
FBtr0083700
3619
FBtr0083702
2120
FBtr0083703
1740
FBtr0113246
2030
FBtr0334523
3196
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0083115
668
FBpp0083114
668
FBpp0083116
406
FBpp0083117
406
FBpp0112158
406
FBpp0306590
668
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
Xrp1-PG
Name Synonyms
Secondary FlyBase IDs
    References (0)