Open Close
General Information
Symbol
Dmel\Syp-PI
Species
D. melanogaster
Annotation Symbol
CG17838-PI
FlyBase ID
FBpp0306763
Associated gene
Length (aa)
603
Theoretical pI
8.77
Predicted MW (kDa)
66.8
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MNKFVSHNLGRDPYRTFSPEMYPLSSPLGPHGTEMAEGNGELLDDINQKADDRGDGERTEDYPKLLEYGLDKKVAGKLDE
IYKTGKLAHAELDERALDALKEFPVDGALNVLGQFLESNLEHVSNKSAYLCGVMKTYRQKSRASQQGVAAPATVKGPDED
KIKKILERTGYTLDVTTGQRKYGGPPPHWEGNVPGNGCEVFCGKIPKDMYEDELIPLFENCGIIWDLRLMMDPMTGTNRG
YAFVTFTNREAAVNAVRQLDNHEIKPGKCLKINISVPNLRLFVGNIPKSKGKDEILEEFGKLTAGLYEVIIYSSPDDKKK
NRGFCFLEYESHKAASLAKRRLGTGRIKVWGCDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVSEDKLKEQFEQYGKV
ERVKKIKDYAFIHFEDRDSAVEAMRGLNGKEIGASNIEVSLAKPPSDKKKKEEILRARERRMMQMMQARPGIVGNLSPTH
PSIMSLTPMRPGARMPLRTPIPREYGSWSWAWNHSTAWQSRWPTWQHQSSGGPNSATGGGSGSGGGTGGGGGSSAGGHRS
GGAGSNRGVPWGVANASQRSWHPARQAATKFTSWSCIQNIHGG
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0334711
3123
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0083958
2301
FBtr0083959
8675
FBtr0083960
2740
FBtr0083962
3146
FBtr0083963
6543
FBtr0083961
6794
FBtr0113256
2214
FBtr0334712
2610
FBtr0334713
7374
FBtr0334714
2837
FBtr0334715
3407
FBtr0334716
4732
FBtr0334717
2862
FBtr0334718
3397
FBtr0334719
2610
FBtr0334720
4448
FBtr0473514
3407
FBtr0473515
3145
FBtr0473516
2884
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0083365
563
FBpp0083366
711
FBpp0083367
529
FBpp0083369
707
FBpp0083370
571
FBpp0083368
529
FBpp0112168
534
FBpp0306764
761
FBpp0306765
753
FBpp0306766
711
FBpp0306767
699
FBpp0306768
665
FBpp0306769
611
FBpp0306770
665
FBpp0306771
761
FBpp0306772
569
FBpp0423032
699
FBpp0423033
670
FBpp0423034
678
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG17838-PI
Syp-PI
Name Synonyms
Secondary FlyBase IDs
    References (0)