Open Close
General Information
Symbol
Dmel\CG17375-PD
Species
D. melanogaster
Annotation Symbol
CG17375-PD
FlyBase ID
FBpp0306866
Associated gene
Length (aa)
242
Theoretical pI
4.34
Predicted MW (kDa)
28.5
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MYYDMVIEFMWSNSFLKSLVYESLGLFDLPDMKQTYSWYVRHILRNECSVMMISEDETQIRAVGLLEWMTEEWHSWVFFP
SSLPRNLFQQIIMMKKELIDATKANMGISTYDALFVHEIAFPDELYFNRDFLSTIFDVFGFVAQHMHMPRVSFIALSSVD
QEAASLIDYEEIGRTIYSIYKVGNTRPFDILRELDEMYALLFELAVSPVLKYIEMPGFEEFHEALDARLAKEAAEKRHDD
DI
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0334841
1280
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0300821
981
FBtr0309813
985
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0290045
268
FBpp0301560
242
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG17375-PD
Name Synonyms
Secondary FlyBase IDs
    References (0)