Open Close
General Information
Symbol
Dmel\Piezo-PJ
Species
D. melanogaster
Annotation Symbol
CG44122-PJ
FlyBase ID
FBpp0307173
Associated gene
Length (aa)
2621
Theoretical pI
8.56
Predicted MW (kDa)
297.3
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MVFSYACMVLQRIVVPAVLVLAALMRPVGISFVYLLMFFVSPFVPLATRRNFKGSVTAFFIILLTLSTLVLLGHITLQIL
AVSLTLPIYNCSFSERLLRHIGFVSFIDLQPFAIIEWLVPEVLVFATSLGSYLTVKRVASQPVGAEQLENGEVVDGQAEN
AQTSSQPSAADANGGDVQQATVTTPLQQQQQQLRKRVSMISQHIHFEGLVKISPLFCLATLFFAAVLRPSVPGGFYFLIF
LLSGTYWATCQTLQRGFALLLRCVMVVLVLHSLSIVSYQTPWMQSHLNHTTLTARLIGLEPLIESYCSPDIRVFLYNNKL
SLDSYLNPFALFFAYFALALTTKHLIKPRVSLRRDQRATLNEPTETTPLVRQSTRKARTPQPLESGSSVAPSVTQRGNDM
QLESMEQRSEQENTTTSILDQISYGFVSVGGFIYQNSYIFTNILMMAWSIVYHSWLTFVLLLSANVLWMIPNQRKAMMRS
SPFIVLYAEALLIAQYIYGMDLNNEELPTSVPTAGINLQQIGFERPIENQMRPCVPLIVKTAFVLMFWVTSRQFFKEKRD
RRRDSTLADFIAPLQITVGSAGSSYLINDGKKTSKFLKKAGDVIKNLLVRLWIWLLVLVIFLCAITGENMTGFRICYMAL
FLFFLLVFQSSSKAWVKIMYGFWLFLIFYAMSILILIYTYQFDKFDTYWSDYLNVSATLQKDIGLKRYQTKDLFLHLVSP
TIIVILTVIQVHYFHKRFIASLQQQPLAGGSAQQKPTETTALEPAPSKRRGSAGSLRKSQGPSAEAAPGATTDFETSVRD
LVRISFRKIKNKSEYIFKNFKDVFWRFLELHIMKAVYIAAFVCSVSEVCVLHIIFVGFCVLGATSRKAVQVVISRLISFI
VTVIVLSKMIYQIEYLSHSQHNVVCSDNRTANNAEWIGLTKADKVTGGLMSLLRTYIIYMVIVTMHAVISLRQLQMRVKI
GALNAPPTKLLFPNIIRADAEKDLVGLVKYLLNFGFYKFGIEISLIALVSTITYRQDIVAVVYALWLVVLLLLRRSQCAK
IWGVFQAFFAISILTQYIVLVGLPPSSCLVFPWDEGPFGEGIQRWAMLPGALHFNHVPKLIFDFIVLVILNRQKSIFCIE
QRYASNDDYPGGSNRSVIADIAQLGRVPFDNPTHDFCSYIRNYSDILKNGVLCGFYWFTLAVVFLAGTNIADLLALGYLI
GAFIFLWQGSDFYLRPIHTIIFRWKWLLAFNVANILIKTSFQMAGCLFMTQLTKDCCWLVHMLGITCTSNVLTEQIMLPE
EAELALKPGECPKITHQVVLLWDTICFAFIIFQLRIFKSHYFCHIITDTKANNILASRGADIIESLRHKQIAHRHDHEKQ
VLHKIKRKMERIRATQQKMLRPLDKQTHFDEHGYPLPAPTVRRRKEIKLHPHATRAGDYYMFEEMDDKFELDLIHDEIDF
LEEENITESEMKMQRRKTLYDKSKDAPTGEFPSTSKGISKERDAATASSSASPAPTRDVGDLPVIPPPSTGLGREQTSKE
TSDSKSKMEVDSGEVTAKDSDEDFDTNPIIRLLEGFLVTLTIRLNRFSRNYRFVNRILAGEKKTLKESSSLNRLGLSSAA
AMFHFLKSNLESDESEPPASSSTPRRVVIAPPNATEHSDPTSTTLNTNTTTTPLSPPEPLQPLQPLQPNTTSTPQQQHQH
IRAAEEIIELPVDTVDGVAHRKQSINSSPPAKGTMLSRKSDCGLPEIRIKAPSIERGAHYYHNHHSGGGSGSLSKHWSYE
QVDSAGEFNLEEENFAQRDHHIIVEVLISSWYALLANTDLICYIVVFINQVVNASLISLPLPIMVFLWGTLSLPRPTKTF
WVTLIAYTQAIVLIKCIFQFKLIWSNYHQLPNQPLTPAKIFGVENKAHYAIYDLILLLVLFLHRYLLKSQGLWKSGYKDT
DNQFTKPTASIDERDDSDNLSQPDSRQLNDDAAQKLSLQVSQASLPGSPEFSKTGINQLERTKYTSSLYKFFFSLVHKSR
LATDVYALMFLCDFVNFFVLLFGFTAFGTQQTESDEGVQTYLAENKVPIPFLIMLLVQFLLIVIDRALYLRKALVNKIIF
HFFSVIGIHIWMFFVVPAVTERTFNSLAPPIIFYVIKCFYMLLSSYQIKSGYPKRILGNFFTKGFSMVNMIAFKVYMQIP
FLYELRTILDWVCIDSTMTIFDWLKMEDIFSNIYLIRCTRQSETDFPAMRAQKKASLSKLIMGGTIVLLIVICIWGPLCL
FALGNAVGTSNVPFHVSLSIRIGPYDPIYTTNNYDSIFEINPEMYSQMTNAYIKEKQALTFIAGYDATDVAAVRLAGNSP
SLWNIAPPDRQRLLNDLRNNHTLKARFSYSLTRKAPAKGLKENVGDEHAISLDESFEGRAALIHMLSETHDVEPIYSNGT
TNGTTPEVEEVVVIPGMIPKFIKVLNSGDAAVVSVLSPKHYDYRPLVIKMHRDNETNGLWWEIRDYCNDTFYNETLSKFA
YSNCTSGIVMYTFNDKKFPSTFSFLTAGGIIGLYTTFVLLASRFMKSFIGGQNRKIMFEDLPYVDRVLQLCLDIYLVREA
LEFALEEDLFAKLLFLYRSPETLIKWTRPKEEYVDDDGDTDSIPSRMSVRRPEQLQPQQPQ
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0335180
9389
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0335175
9714
FBtr0335176
9600
FBtr0335177
9645
FBtr0335178
9297
FBtr0335179
9240
FBtr0335181
9300
FBtr0335182
9240
FBtr0335183
9186
FBtr0347414
10101
FBtr0347415
10506
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0307168
2709
FBpp0307169
2671
FBpp0307170
2686
FBpp0307171
2570
FBpp0307172
2551
FBpp0307174
2571
FBpp0307175
2551
FBpp0307176
2533
FBpp0312564
2838
FBpp0312565
2973
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG44122-PJ
Piezo-PJ
Name Synonyms
Secondary FlyBase IDs
    References (0)