Open Close
General Information
Symbol
Dmel\PGAP5-PC
Species
D. melanogaster
Annotation Symbol
CG8455-PC
FlyBase ID
FBpp0307180
Associated gene
Length (aa)
367
Theoretical pI
8.25
Predicted MW (kDa)
42.9
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MRFLYACFVIVLCALIFCEYVADFVVLQKCKWPEIKRKKYVDDPLRAMILADPHLLGPHRGHWLDKLYREWHMTRAFQAA
SRLFQPDVVFVLGDLFDEGDMVSDKQFQEYVWRYLKMFHLPPGIPLISVAGNHDVGFHYKMHPFFMSRFESYLNNSSVNL
YTIKQIHFVVINSMAMEGDGCMFCTQAEDQLKNISRTLYCMKYPLEAECARTRRHPYSQPILLQHFPTYRISDTMCEEHD
APYIEAFRERFHVLSKDATDMLGELLKPRLAFAGHSHHFCHSVNRLGIDEYTVASFSWRNKVNPSFMLATITPDDYVVSK
CKMLPQQFVFNSYLSAGILCLIVIGFQLRKCIQSRRQSSAVDHRKVN
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0335190
1566
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0079587
1565
FBtr0079588
1500
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0079208
367
FBpp0079209
370
External Crossreferences and Linkouts ( 2 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
Synonyms and Secondary IDs (2)
Reported As
Symbol Synonym
CG8455-PC
PGAP5-PC
Name Synonyms
Secondary FlyBase IDs
    References (0)