Polypeptide Dmel\l(2)37Cg-PD

General Information
Symbol	Dmel\l(2)37Cg-PD	Species	D. melanogaster
Annotation Symbol	CG10685-PD	FlyBase ID	FBpp0307611
Associated gene	Dmel\l(2)37Cg

Length (aa)	132	Theoretical pI	6.01
Predicted MW (kDa)	15.2

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MARGRGEEHSNQWKQNTLVETSARYRYIDDVTTLAGDEKNGEGSRTFVFT NEGHTLGNALKTIIARYPEVDFCGYTIPHPTEQKLHFRIQSRRDRAIDIL KRGLEDLEGLCDHTIVTFEKEMAEFNAMKVEN
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) l(2)37Cg-RD FBtr0336628 681
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) l(2)37Cg-RA FBtr0081161 404 l(2)37Cg-RC FBtr0332577 633
Other Polypeptides
	Name FlyBase ID Length (aa) l(2)37Cg-PA FBpp0080704 105 l(2)37Cg-PC FBpp0304829 116
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_001260563 DDBJ / EMBL / GenBank • AGB93098
Synonyms
	l(2)37Cg-PD
References ( 1 )
FlyBase analysis	FlyBase Genome Annotators, 2004, Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. [FBrf0166453]