Open Close
General Information
Symbol
Dmel\CoRest-PK
Species
D. melanogaster
Annotation Symbol
CG42687-PK
FlyBase ID
FBpp0307648
Associated gene
Length (aa)
268
Theoretical pI
6.89
Predicted MW (kDa)
30.0
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MVLAERNTTDVVRNGRRSRGPSPNTHTTGGVTNSASLVGSGNNSGHSGNANANEKTTTAVPGAGTPESSDDDNSTKRNGK
SKAKQSEYEEKIRVGRDYQAVCPPLVPEAERRPEQMNERALLVWSPTKEIPDLKLEEYISVAKEKYGYNGEQALGMLFWH
KHDLERAVMDLANFTPFPDEWTIEDKVLFEQAFQFHGKSFHRIRQMLPDKSIASLVKYYYSWKKTRHRSSAMDRQEKAIK
AVVKDGSENGSEVGSNEESDNDDKVIIC
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0336667
1834
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0302860
1839
FBtr0302861
1800
FBtr0302859
2085
FBtr0302862
3290
FBtr0302864
3296
FBtr0302863
3998
FBtr0307901
3155
FBtr0307902
3255
FBtr0307903
2203
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0292000
273
FBpp0292001
273
FBpp0291999
273
FBpp0292002
588
FBpp0292004
590
FBpp0292003
824
FBpp0300335
824
FBpp0300336
824
FBpp0300337
336
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CoRest-PK
Name Synonyms
Secondary FlyBase IDs
    References (0)