Open Close
General Information
Symbol
Dmel\Asph-PL
Species
D. melanogaster
Annotation Symbol
CG8421-PL
FlyBase ID
FBpp0307715
Associated gene
Length (aa)
991
Theoretical pI
4.00
Predicted MW (kDa)
113.3
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MSGDVQPRKRKDKRRKRDDDESSHGVHITKMGNEDLHLHVHHDHGTGGHWCAKIIFFALMAVLLGLVGLIIMENRGLEDL
DTPLSESRFSKVFDGWVDEHRDEHDGHDVQEPSGEALDDHDEHDDHDDHEDEEPLTEELEEELEEEEEPTEEDEPAADEE
YEEDEDEENNAGENITAEDAEEEEEEEDNDDEGTVEATVEATTEATTEATGEYEAEEDDEDEAAADDDAVESTEAPLSKA
EEQEDDEDEDEEEQEIEESVEPERSQYAAQSAPAKDNNDDDDDDDQDKNDADDGDDDEFESLAQQFENDPEDTVPAKAVE
SEEQDQDQADEEEPKEEGSSWLASLAVKFGVGVALALVSRLVLIRKSPNTTEDEPAPETIFRRRLTIATAEDHIPDDVEE
LPPLDDEYSEEEIEIEEEIEVEISDIEEEEEEVRHDNDDNVASMASYVPETFEQLSAMYKYAQEPTKDAKPEQKEKEPEK
PVGHSDIYVEYEDGAIEDYEHDGVSDEEITDEEDEISDVDDADLMNRLEAKYGRLPVKEFESDPDSDDPSWTQIKPKEAA
PAPAEKEDPFEQELRKANEEMIRENYAQALRSFNTLTTNFAHEPSAHLGRARLLELLAKKERSNQRLWEAIDAYKRYLAF
GELVASNQEFQTAGESCIENLRFLGHHRQATTIHELLINRLPEDPRLRNQLSLTYLMVNNLQQVEKVAVETLKLWPNNAV
AQLHYGLALRQFHADYAKALPYLKYAVESGEEGTQEAFFYLSLGETMQRLSMKSEALEVYGKGVAKGFFASLYQRSLYNE
PRLRAQPFWQPKETGYERQLEKLTLNWRAIRDEGLALLGRSGFFEDEAELLRDKGVWQQYELYAQGRRVKDNCRRAPITC
SLLEEFPESAGCRRGQVKFSVMQAKTHVWPHCGPTNCRLRAHLTLAAPEPEKASLRVAEQERTWREGELFIFDDSFEHEV
WHNGSQSRLVLILDMWHPQLSAAQRRSLSPI
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0336734
3518
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0087220
2729
FBtr0087219
3143
FBtr0300575
3928
FBtr0305090
2783
FBtr0305091
3986
FBtr0305092
3197
FBtr0310447
3929
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0086359
785
FBpp0086358
382
FBpp0289802
557
FBpp0293627
803
FBpp0293628
575
FBpp0293629
400
FBpp0302595
556
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
Asph-PL
Name Synonyms
Secondary FlyBase IDs
    References (0)