Polypeptide Dmel\wupA-PM

General Information
Symbol	Dmel\wupA-PM	Species	D. melanogaster
Annotation Symbol	CG7178-PM	FlyBase ID	FBpp0307837
Associated gene	Dmel\wupA

Length (aa)	184	Theoretical pI	10.41
Predicted MW (kDa)	21.6

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MEEASKAKKAKKGFMTPERKKKLRLLLRKKAAEELKKEQERKAAERRRII EERCGSPRNLSDASEDTLKSLIKQHYDRINKLEDQKYDLEYVVKRKDVEI NDLNAQVNDLRGKFVKPALKKVSKYENKFAKLQKKAAEFNFRNQLKVVKK KEFTLEEEEKEKKPDWSKGKPGDAKVKEEVEAEA
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) wupA-RM FBtr0336897 1347
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) wupA-RA FBtr0074520 1160 wupA-RB FBtr0074521 1160 wupA-RC FBtr0074522 1160 wupA-RD FBtr0074523 1160 wupA-RE FBtr0074526 1129 wupA-RF FBtr0074525 1129 wupA-RG FBtr0074524 1343 wupA-RH FBtr0308235 1212 wupA-RI FBtr0308236 1029 wupA-RJ FBtr0308237 1039 wupA-RK FBtr0336895 1159 wupA-RL FBtr0336896 1248
Other Polypeptides
	Name FlyBase ID Length (aa) wupA-PA FBpp0074294 208 wupA-PB FBpp0074295 208 wupA-PC FBpp0074296 208 wupA-PD FBpp0074297 208 wupA-PE FBpp0074300 208 wupA-PF FBpp0074299 208 wupA-PG FBpp0074298 269 wupA-PH FBpp0300555 260 wupA-PI FBpp0300556 199 wupA-PJ FBpp0300557 199 wupA-PK FBpp0307835 184 wupA-PL FBpp0307836 184
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_001259670 DDBJ / EMBL / GenBank • AGB95512
Synonyms
	wupA-PM
References ( 1 )
FlyBase analysis	FlyBase Genome Annotators, 2004, Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. [FBrf0166453]