Polypeptide Dmel\CG17574-PK

General Information
Symbol	Dmel\CG17574-PK	Species	D. melanogaster
Annotation Symbol	CG17574-PK	FlyBase ID	FBpp0307958
Associated gene	Dmel\CG17574

Length (aa)	153	Theoretical pI	9.98
Predicted MW (kDa)	16.4

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MVFFIVVLILVLLRVRRARRLRVGNATVVTAAPVVVTSATHTAPGGYPVT QLPPPGYPSSNAYVTATSYPVQTTGNVTVQMPMPMSHQNQQQMPMPMPMP GQQTHGVAYPTYPGAGAANMNPPPYDMSMANPGPSVMPAGYEKQAPYNPH FGQ
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) CG17574-RK FBtr0337029 841
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) CG17574-RA FBtr0087816 1162 CG17574-RE FBtr0306579 1026 CG17574-RF FBtr0306580 882 CG17574-RG FBtr0306581 921 CG17574-RH FBtr0306582 996 CG17574-RI FBtr0306583 965 CG17574-RJ FBtr0331979 1165
Other Polypeptides
	Name FlyBase ID Length (aa) CG17574-PA FBpp0086929 156 CG17574-PE FBpp0297534 174 CG17574-PF FBpp0297535 162 CG17574-PG FBpp0297536 164 CG17574-PH FBpp0297537 174 CG17574-PI FBpp0297538 175 CG17574-PJ FBpp0304304 157
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_001097294 DDBJ / EMBL / GenBank • ABV53783
Synonyms
	CG17574-PK
References ( 1 )
FlyBase analysis	FlyBase Genome Annotators, 2004, Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. [FBrf0166453]