Polypeptide Dmel\grp-PF

General Information
Symbol	Dmel\grp-PF	Species	D. melanogaster
Annotation Symbol	CG17161-PF	FlyBase ID	FBpp0308597
Associated gene	Dmel\grp

Length (aa)	398	Theoretical pI	8.54
Predicted MW (kDa)	45.3

Map ( GBrowse )
Recent Updates
Description	What does this section display? This section contains items that were added to this record for each release. It currently only tracks new links between this FlyBase report and other FlyBase data classes (e.g. genes, references, stocks) or controlled vocabulary terms (e.g. GO, anatomy terms). What does this section not display? This section does not currently display links that were removed or gene model changes.
Update Feed	Click the icon below to subscribe to this FlyBase record and receive updates automatically through your feed reader.
FB2013_03
FB2013_02
All updates	Click here to see a list of all updates to this record from FB2010_08 and on.
Sequence
	MPQHEAQRYFTQLLSGLNYLHQRGIAHRDLKPENLLLDEHDNVKISDFGM ATMFRCKGKERLLDKRCGTLPYVAPEVLQKAYHAQPADLWSCGVILVTML AGELPWDQPSTNCTEFTNWRDNDHWQLQTPWSKLDTLAISLLRKLLATSP GTRLTLEKTLDHKWCNMQFADNERSYDLVDSAAALEICSPKAKRQRLQSS AHLSNGLDDSISRNYCSQPMPTMRSDDDFNVRLGSGRSKEDGGDRQTLAQ EARLSYSFSQPALLDDLLLATQMNQTQNASQNYFQRLVRRMTRFFVTTRW DDTIKRLVGTIERLGGYTCKFGDDGVVTVSTVDRNKLRLVFKAHIIEMDG KILVDCRLSKGCGLEFKRRFIKIKNALEDIVLKGPTTWPIAIATNSVP
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide	Name FlyBase ID Length (nt) grp-RF FBtr0339514 2010
Corresponding to OTHER polypeptides	Name FlyBase ID Length (nt) grp-RA FBtr0080886 2563 grp-RB FBtr0080884 2234 grp-RC FBtr0080885 2344 grp-RD FBtr0100459 1649
Other Polypeptides
	Name FlyBase ID Length (aa) grp-PA FBpp0080443 512 grp-PB FBpp0080441 512 grp-PC FBpp0080442 512 grp-PD FBpp0099886 398
External Crossreferences
	RefSeq - An integrated, non-redundant set of sequences • NP_001260508 DDBJ / EMBL / GenBank • AGB93043
Synonyms
	grp-PF
References ( 2 )
FlyBase analysis	FlyBase Genome Annotators, 2005, Changes affecting gene model number or type in release 4.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 4.2 of the annotated D.melanogaster genome. [FBrf0182792] FlyBase Genome Annotators, 2004, Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. Changes affecting gene model number or type in release 3.2 of the annotated D.melanogaster genome. [FBrf0166453]