Open Close
General Information
Symbol
Dmel\Mppe-PD
Species
D. melanogaster
Annotation Symbol
CG8889-PD
FlyBase ID
FBpp0308657
Associated gene
Length (aa)
364
Theoretical pI
9.28
Predicted MW (kDa)
42.8
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MASLRVVNRLVCRGFVALTLLLVFFNEFIVYYMAQSSWQPIDCKLDNCTRLLLIADPQILGNSYDRSSHSPLARYDSDRY
LAKTFERALAFTQPHIIVFLGDLLDEGNIATAQEYKQYVQRFRRIYQNKNYKKFRMISAFFQRVHVPGDNDIGGENGDYI
SNSNQRRFENEFMSEDLFDYDNRLRFFKINRMLLDFSNPDRDNNADRLRIGVSHAPLLIGGGPLLRAIISDLDPHIIFSG
HWHESRIFIYPSTKVINFYENSVRHFDLKALKEQEHSYLEIMVPTCSYRMGKSKIGLGYAVLENYNLSYTVLWQPNRFIL
LFTYVFWGLFVVCGFVVFKMMTRCPFRVAKRQTLYNRVSTIPQF
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0339582
1784
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0088024
1757
FBtr0088025
1763
FBtr0339583
1790
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0087131
355
FBpp0087132
357
FBpp0308658
366
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
Mppe-PD
Name Synonyms
Secondary FlyBase IDs
    References (0)