Open Close
General Information
Symbol
Dmel\Cpr49Ac-PE
Species
D. melanogaster
Annotation Symbol
CG8502-PE
FlyBase ID
FBpp0308693
Associated gene
Length (aa)
285
Theoretical pI
6.86
Predicted MW (kDa)
32.9
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MFTKSMLSFSLVVALFVVCHASPVPDNNGRYHHMPIPYRHVSDQRELGKYHHIPYPYDGGYGPYAGSNIPYVHDDRPYNH
DLYTSTTTKKPTTTTKRTTTSTTTTTTTPRNILFNYDDEGRHKILHKEEVRKQDKYDHSYLTENGIYGEEQAKLHHTGGT
HAKGFYEYTGDDGKLYRVNYASNDGGFMPQGDHIHPIPDAIVRALKYVEEQHKINGGAQFDHRGFRINHMTKDLKAQIKA
IHLEEMPKELTEQIHMLEHEVELAEEEEREEQAALERLRQAAKSH
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0339630
1317
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0087917
1344
FBtr0087916
1434
FBtr0301372
1733
FBtr0339631
1407
FBtr0345948
1701
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0087028
294
FBpp0087027
324
FBpp0290586
123
FBpp0308694
315
FBpp0311862
315
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
Cpr49Ac-PE
Name Synonyms
Secondary FlyBase IDs
    References (0)