Open Close
General Information
Symbol
Dmel\fdl-PE
Species
D. melanogaster
Annotation Symbol
CG8824-PE
FlyBase ID
FBpp0308699
Associated gene
Length (aa)
672
Theoretical pI
7.07
Predicted MW (kDa)
77.1
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MLLTRRLRYLYKMSLAVSLRRALLVLLTGAIFILTVLYWNQGVTKAQAYNEALERPHSHHDASGFPIPVEKSWTYKCEND
RCMRVGHHGKSAKRVSFISCSMTCGDVNIWPHPTQKFLLSSQTHSFSVEDVQLHVDTAHREVRKQLQLAFDWFLKDLRLI
QRLDYVGSSSEPTVSESSSKSRHHADLEPAATLFGATFGVKKAGDLTSVQVKISVLKSGDLNFSLDNDETYQLSTQTEGH
RLQVEIIANSYFGARHGLSTLQQLIWFDDEDHLLHTYANSKVKDAPKFRYRGLMLDTSRHFFSVESIKRTIVGMGLAKMN
RFHWHLTDAQSFPYISRYYPELAVHGAYSESETYSEQDVREVAEFAKIYGVQVIPEIDAPAHAGNGWDWGPKRGMGELAM
CINQQPWSFYCGEPPCGQLNPKNNYTYLILQRIYEELLQHTGPTDFFHLGGDEVNLDCWAQYFNDTDLRGLWCDFMLQAM
ARLKLANNGVAPKHVAVWSSALTNTKCLPNSQFTVQVWGGSTWQENYDLLDNGYNVIFSHVDAWYLDCGFGSWRATGDAA
CAPYRTWQNVYKHRPWERMRLDKKRKKQVLGGEVCMWTEQVDENQLDNRLWPRTAALAERLWTDPSDDHDMDIVPPDVFR
RISLFRNRLVELGIRAEALFPKYCAQNPGECI
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0339637
2854
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0087947
2094
FBtr0087946
3062
FBtr0346633
3514
FBtr0474148
3062
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0087058
673
FBpp0087057
660
FBpp0312213
660
FBpp0423147
664
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
fdl-PE
Name Synonyms
Secondary FlyBase IDs
    References (0)