Open Close
General Information
Symbol
Dmel\CG43394-PD
Species
D. melanogaster
Annotation Symbol
CG43394-PD
FlyBase ID
FBpp0308729
Associated gene
Length (aa)
537
Theoretical pI
4.41
Predicted MW (kDa)
59.1
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MILRTHLWLGVLLAALLLNTVVSGEDEDYGGEMIGSSLGGNDEIYDPAQLEAEVEKEMEQHRNSLEEDQTESSQVMELEV
STMRPMESRMNTMAPYSGENSSAEMIDDASTQKRVSKVDKPARDYYYEDAPEDEMVASTTAKVATTMIPEYVRQAKAERF
PQRDQEHTSTDYIEEDATKSVDEEPPADQFYRVEQHEPIPQAQVQQLPSRDKPKPFEYSSEDDYYDEHAEAKTTTTSTST
TQAPLPILRARFGGFPWATTQAPSPPTTSSTSSTTTTSTTTTTTTTSTTTTPSPRKQPKHIQVTGGLKPELLPADQLRNY
IKDVYIRMPLAVIVDPSSASLEQAKRLYIDALQDKNIDIKIVLVTLNAAGAPSAFSFNNTREFIAGLNSTKEHEGGNSFV
GVLHAAELVPYDSAVFISTAVIPPHTELVQDAAITLLKKRIRLFLLWYGERSGSENETEDAVGGILGEVAIRSGGEIIHI
VSTEHGQHIAGNTLTLVADAYQGSQELDLPVDTTLSSLHVRIDANMRRATMETPNGG
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0339672
2365
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0308298
2675
FBtr0308299
3496
FBtr0330321
3186
FBtr0344862
2468
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0300617
537
FBpp0300618
948
FBpp0303353
948
FBpp0311177
525
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/TrEMBL - Automatically annotated and unreviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
CG43394-PD
Name Synonyms
Secondary FlyBase IDs
    References (0)