Open Close
General Information
Symbol
Dmel\SPR-PB
Species
D. melanogaster
Annotation Symbol
CG16752-PB
FlyBase ID
FBpp0308828
Associated gene
Length (aa)
435
Theoretical pI
7.37
Predicted MW (kDa)
50.3
Genomic Location
Protein Domains
Protein Domains (via Pfam)
Isoform displayed:
Pfam protein domains
InterPro name
classification
start
end
Protein Domains (via SMART)
Isoform displayed:
SMART protein domains
InterPro name
classification
start
end
Sequence
MDNYTDVLYQYRLAPSASPEMEMELADPRQMVRGFHLPTNESQLEIPDYGNESLDYPNYQQMVGGPCRMEDNNISYWNLT
CDSPLEYAMPLYGYCMPFLLIITIISNSLIVLVLSKKSMATPTNFVLMGMAICDMLTVIFPAPGLWYMYTFGNHYKPLHP
VSMCLAYSIFNEIMPAMCHTISVWLTLALAVQRYIYVCHAPMARTWCTMPRVRRCTAYIALLAFLHQLPRFFDRTYMPLV
IEWNGSPTEVCHLETSMWVHDYIGVDLYYTSYYLFRVLFVHLLPCIILVTLNILLFAAMRQAQERRKLLFRENRKKECKK
LRETNCTTLMLIVVVSVFLLAEIPIAVVTAMHIVSSLIIEFLDYGLANICIMLTNFFLVFSYPINFGIYCGMSRQFRETF
KEIFLGRLMAKKDSSTKYSIVNGARTCTNTNETVL
Other Products of this Gene
Transcripts
Corresponding to THIS polypeptide
Name
FlyBase ID
Length (nt)
FBtr0339781
3357
Corresponding to OTHER polypeptides
Name
FlyBase ID
Length (nt)
FBtr0070778
3093
FBtr0344824
2804
FBtr0479797
3093
Other Polypeptides
Name
FlyBase ID
Length (aa)
FBpp0070744
435
FBpp0311140
435
FBpp0428130
512
External Crossreferences and Linkouts ( 3 )
Crossreferences
GenBank Protein - A collection of sequences from several sources, including translations from annotated coding regions in GenBank, RefSeq and TPA, as well as records from SwissProt, PIR, PRF, and PDB.
RefSeq - A comprehensive, integrated, non-redundant, well-annotated set of reference sequences including genomic, transcript, and protein.
UniProt/Swiss-Prot - Manually annotated and reviewed records of protein sequence and functional information
Synonyms and Secondary IDs (1)
Reported As
Symbol Synonym
SPR-PB
Name Synonyms
Secondary FlyBase IDs
    References (0)